KEGG   Petrotoga mobilis: Pmob_1208Help
Entry
Pmob_1208         CDS       T00621                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00260  Glycine, serine and threonine metabolism
pmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01130  Biosynthesis of antibiotics
pmo01230  Biosynthesis of amino acids
Module
pmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pmob_1208
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmob_1208
Enzymes [BR:pmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pmob_1208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PrpR_N
Motif
Other DBs
NCBI-ProteinID: ABX31925
UniProt: A9BHQ3
Position
complement(1291103..1292284)
Genome map
AA seq 393 aa AA seqDB search
MKKAYFGQYGGRYVPETLIPALEELEEAHEKYSKDPDFINEYQGLLKDYCGRPTPLYFAE
RFTEYLNGPKIYLKREDLNHTGAHKINNALGQVLLAKRMNKKRIIAETGAGQHGVATATA
AARFGLECIVYMGAEDIRRQALNVYKMRMLGAKVVPVYSGSQTLKEAINEAIRDWVTNVE
NTHYVIGSVVGPHPYPKIVRDFQRVIGDESKNQILEKEGRLPDYIVACVGGGSNAMGIFY
PFIEDKDVELIGVEAAGKGLETGQHAASLTAGKIGVLHGSKSYVLQDDDGQIQLAYSISA
GLDYPGVGPEHSYLHDEKRAQYVSITDEEALKGFELLTKLEGIIPAFESSHAIAYAMKIA
PSLDKDKIMVINLSGRGDKDVDSYIKLGREALE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcttattttggtcagtatggaggtagatacgttccagagacattgattcca
gcgctcgaagagttggaggaagctcacgaaaaatattcaaaagatcctgattttataaat
gaataccaaggtttgttgaaagattactgtggaaggcccacccctttatattttgctgaa
agatttaccgaatatcttaatggtccaaaaatatatctaaaaagggaagatttaaaccat
acgggggcgcacaaaattaataacgcgttggggcaagtattacttgcaaaaagaatgaat
aaaaaaagaataatagcagagaccggtgcaggccagcatggtgtggcaacagcaaccgct
gcagctagatttgggttggaatgtatagtttacatgggggcagaagatatcagaagacaa
gcgctcaatgtatacaaaatgaggatgttgggagcaaaagtagtgcctgtatacagcggt
agccaaactttaaaggaagccataaatgaagctattagagactgggttacaaacgtagaa
aacacccactacgttataggttctgttgtaggaccacatccataccctaaaatagttaga
gattttcaaagggttattggtgatgaatctaaaaatcagattttagaaaaagaaggaagg
ttgcctgattatatagttgcatgtgttggcggaggtagtaacgctatgggtatattctac
ccttttatagaagataaagatgttgaattgataggagtggaagctgcaggaaaaggatta
gaaactggccaacatgccgcttctttaactgcggggaaaataggggtccttcacgggagt
aaatcttacgtcttacaagatgatgacggtcaaattcaactggcatattctatttctgca
ggtttagattatccgggtgtgggacctgaacatagttatctacatgatgaaaaaagagct
cagtatgtatcgataacagatgaagaagcgttgaaaggttttgaacttttaacgaaattg
gagggaatcatcccagcatttgaaagttcccatgcaatagcttacgctatgaaaattgca
ccatcacttgataaagataaaatcatggtaataaatctttctggaagaggagacaaagat
gtcgattcttatataaaacttggtagggaggcactagaatga

DBGET integrated database retrieval system