KEGG   Petrotoga mobilis: Pmob_1210Help
Entry
Pmob_1210         CDS       T00621                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01130  Biosynthesis of antibiotics
pmo01230  Biosynthesis of amino acids
Module
pmo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pmob_1210
Enzymes [BR:pmo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pmob_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth FlgN
Motif
Other DBs
NCBI-ProteinID: ABX31927
UniProt: A9BHQ5
Position
complement(1293377..1294138)
Genome map
AA seq 253 aa AA seqDB search
MYLEKIVETKREEVAKLKEKKISLKDSFQKGKLTLIAEIKKASPSKGIISTNFDPQRQLE
LYIKGGADAISILTDEKYFQGSTNILKELRPKTNLPILRKDFIIDPIQIYQSLFLGANVI
LLIASILTKKEISNFLKISKDIGLEAIVEVHNHQELTKVLDTETEILGINNRDLSDFSLS
LRNTEKLLEELEKLGKRRDFYVISESGIKEKSDIDYLRSLEVDGVLIGEALMKENDPVLK
IGELFPEKRSNLQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtatttagaaaagatagtagaaacaaaaagggaagaagtagcaaagctaaaagaaaag
aaaatctccttaaaagactccttccaaaaaggaaaattaactttaatagcggaaatcaaa
aaagcctcgccaagtaaagggatcatttcaacgaattttgacccacaaaggcagttagag
ttatatataaaaggtggtgcagatgctatttctattctaactgatgaaaaatattttcaa
ggtagtacaaatattttaaaagaattaagacccaaaacaaaccttcctattttaagaaaa
gatttcataatcgatcctatacagatctaccagtcgttatttctgggggccaacgttatt
ttactcatagcttcaatactaacaaaaaaagagatttctaattttcttaagatatcaaaa
gatataggtttagaagccatagtcgaagttcataaccatcaagaattaacaaaggtttta
gataccgaaactgaaattttagggataaacaacagagatttgagtgatttttctcttagc
ctaagaaacacggaaaaattacttgaagaacttgaaaaattaggtaaacgaagagatttt
tatgtgatttcagaaagcgggattaaagaaaaaagtgacatcgattaccttagaagttta
gaagtagatggggtattaataggagaagctctaatgaaagaaaacgatcctgttttgaag
attggagaactatttccagaaaaaaggagtaatttacagtga

DBGET integrated database retrieval system