KEGG   Petrotoga mobilis: Pmob_1916Help
Entry
Pmob_1916         CDS       T00621                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pmo  Petrotoga mobilis
Pathway
pmo00010  Glycolysis / Gluconeogenesis
pmo00030  Pentose phosphate pathway
pmo00051  Fructose and mannose metabolism
pmo00052  Galactose metabolism
pmo00680  Methane metabolism
pmo01100  Metabolic pathways
pmo01110  Biosynthesis of secondary metabolites
pmo01120  Microbial metabolism in diverse environments
pmo01130  Biosynthesis of antibiotics
pmo01200  Carbon metabolism
pmo01230  Biosynthesis of amino acids
pmo03018  RNA degradation
Module
pmo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pmob_1916
   00030 Pentose phosphate pathway
    Pmob_1916
   00051 Fructose and mannose metabolism
    Pmob_1916
   00052 Galactose metabolism
    Pmob_1916
  Energy metabolism
   00680 Methane metabolism
    Pmob_1916
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pmob_1916
Enzymes [BR:pmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pmob_1916
Protein phosphatases and associated proteins [BR:pmo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pmob_1916
Messenger RNA biogenesis [BR:pmo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pmob_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK AP_endonuc_2 PhoH
Motif
Other DBs
NCBI-ProteinID: ABX32603
UniProt: A9BID1
Position
2121021..2122028
Genome map
AA seq 335 aa AA seqDB search
MKYKIIKIFRRDTVSEVKKIGLMTSGGDAPGMNAVIRAVTRSAVVENIEVYGFLRGFAGI
LDKEYKKLTYSDVGGIMERGGTILRTSRVPEFKVPEVRKKAADILKDLGIDVLVIIGGNG
SLTGGKLLAEEQGISVVGVPASIDNDIAYTDMSIGVDTCLNTVVDAMQKLKDTASSHERA
FIVEVMGRTSGYIALMSGLAIGAEAIIIPEVPTDYDALAEKMWDERKRGKINSIVVVAEG
SASAYTVARHLENRIGFETRITILGHIQRGGSPTAFDRILASRMGNEVVKSIKDGNFNVM
VGLSKNDLIRTPLEKVLSENNKLDMEIVKLAGILS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataaaataataaagatttttaggagggatacagtgagtgaggttaaaaaaatc
ggtttaatgaccagtggtggagatgcacctggaatgaacgctgttattagggctgttaca
agaagtgcagtagtggaaaatatcgaagtgtatgggtttttgagaggatttgctggtatt
ttagataaagaatataaaaaactaacatattcagatgttggtggaataatggaaagaggg
ggaaccattttaagaacctctcgagtaccagaattcaaagttcctgaagttagaaaaaaa
gctgctgatatattgaaggatttaggtatagatgtgttagttataattgggggtaacggg
agtcttactgggggaaagttgctagcagaagaacaagggatatctgtagtaggcgtaccg
gcttctatagacaacgatattgcatataccgatatgagcataggtgttgatacctgtctt
aacacagtagttgatgccatgcaaaagttaaaagataccgcttcttcccacgaaagggct
tttatcgtcgaagttatgggaaggacatctggatacatagcgttgatgtcaggtcttgct
ataggtgcggaagctataataataccagaagttcccaccgattacgatgctttagcagaa
aaaatgtgggatgaaagaaaaaggggtaagattaattcaatagtcgttgttgcggaggga
tctgccagcgcctatacagtcgccagacatttagaaaatagaattggttttgaaacgcgt
ataacaattttaggccatattcaaagagggggttctcctactgcattcgatagaattttg
gcttcgagaatggggaacgaagtagtaaaatcaattaaagacggaaattttaacgtgatg
gtgggcttgagtaaaaacgatttaataagaacacctcttgaaaaagtgctttctgaaaat
aataaattggatatggagattgtaaagctggcagggattttatcctag

DBGET integrated database retrieval system