KEGG   Pseudomonas monteilii SB3078: X969_01165Help
Entry
X969_01165        CDS       T02972                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00130  Ubiquinone and other terpenoid-quinone biosynthesis
pmon00627  Aminobenzoate degradation
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01120  Microbial metabolism in diverse environments
pmon01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    X969_01165
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    X969_01165
Enzymes [BR:pmon01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     X969_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AHC80631
Position
235471..236100
Genome map
AA seq 209 aa AA seqDB search
MSGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQLVMATETDVVLPAKPQA
MQAFLTEYTGAADGQIRVYGKEDWMSPVASGSGAPAAMVVVPCSTGTLSAIATGACNNLI
ERAADVTLKERRQLILVPREAPFSTIHLENMLKLSQMGAVILPAAPGFYHQPQTIDDLVD
FVVARILNLLNIPQDMLPRWGEHHFGVDD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgggccggaacgcatcaccctggccatgacgggcgcctctggtgcccagtatggc
ctgcgcctgctcgactgcctggtgcgtgaggaccgcgaggtgcacttcctgatctccaag
gccgcgcaactggtgatggccaccgagacggacgtggtgctgccggccaagccacaggcg
atgcaggctttcctcaccgaatataccggcgctgccgacgggcagatccgcgtgtatggc
aaggaagactggatgtcgccggtggcctcgggctccggcgccccggcggcaatggtagtg
gtgccctgttccactggcacgctgtcggcgattgccaccggtgcctgcaacaacctgatc
gaacgtgctgccgacgttaccctcaaggagcgtcgccagctgatcctggtgccgcgcgag
gcgccgttctccaccatccacctggagaacatgctcaagctgtcgcagatgggcgcggtg
atcctgccggcggcgccgggcttttatcaccagccgcagaccatcgacgacctggtcgac
ttcgtggtggcgcgcattctcaacctgctgaacattcctcaggacatgttgccgcgctgg
ggcgagcaccacttcggggtggatgattga

DBGET integrated database retrieval system