KEGG   Pseudomonas monteilii SB3078: X969_02645Help
Entry
X969_02645        CDS       T02972                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00450  Selenocompound metabolism
pmon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    X969_02645
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmon03016]
    X969_02645
Enzymes [BR:pmon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     X969_02645
Transfer RNA biogenesis [BR:pmon03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    X969_02645
 Prokaryotic Type
    X969_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AHC80906
Position
complement(553390..554424)
Genome map
AA seq 344 aa AA seqDB search
MSEPIRLTQYSHGAGCGCKISPKVLDVILAESGAQALDPKLWVGNASRDDAAVYALDDER
GVVSTTDFFMPIVDDPYDFGRIAATNAISDIYAMGGDPLMAIAILGWPVNVLPPEVAREV
IRGGRAVCAEAGIPLAGGHSIDAPEPIFGLAVTGVVSKRHLKRNDTASARCRLYLTKPLG
IGILTTAEKKAKLRTQDQGLARDWMCTLNTPGSRFGKLDGVKAMTDVTGFGLLGHLVELA
EGSGVTAHLDYAAVPRLPSVDHYLAEGCIPGGTLRNFDSYGHKIGALSDDQKHLLCDPQT
SGGLLVAVTPEGEAEFLAVAAELGLQLAPIGKLVERQSHAVEVI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgattcgcctgacccagtacagccatggtgccggctgtggctgcaagata
tcccccaaggtgctggatgtgatcctcgcagaaagcggcgcccaggccctggacccgaaa
ctgtgggtgggcaacgcctcgcgcgacgacgctgccgtgtacgcgctggatgacgagcgc
ggtgtggtctcgaccaccgacttcttcatgccgatcgtcgatgacccgtacgacttcggc
cgtatcgccgccaccaacgccatcagcgacatctacgccatgggcggcgacccgctgatg
gccattgccattctcggctggccggtcaacgtgctgccaccggaagtggcccgcgaagtg
atccgcggcggccgtgcggtatgcgccgaagccggtatcccgctggccggcggccactcc
atcgacgcccccgagccgatcttcggcctggccgtcaccggcgtggtcagcaagcgtcac
ctcaagcgcaacgacaccgccagcgcacgctgccgcctgtacctgaccaagccactgggt
atcggcatcctcaccaccgccgagaaaaaggccaagctgcgcacccaggaccagggcctt
gcccgcgactggatgtgcaccctcaacacgcccggcagccgcttcggcaagcttgacggg
gtcaaggccatgaccgacgtcaccggtttcggcctgctcggccacctggtggaactggcc
gaaggcagtggcgttaccgcgcacctggactatgctgccgtcccgcgcctgcccagcgtc
gaccactacctggccgagggctgcatccccggcggcaccctgcgcaacttcgacagctac
ggccacaagatcggcgccctgagcgacgaccagaagcatctgctgtgcgacccgcagacc
agcggaggcctgctggtggcggttaccccggagggtgaagccgagttcctcgcggtagcc
gccgaactgggcctgcaactggcgccgatcggcaagctggtcgagcgacagagccacgcg
gtcgaggtgatctga

DBGET integrated database retrieval system