KEGG   Pseudomonas monteilii SB3078: X969_06480Help
Entry
X969_06480        CDS       T02972                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00020  Citrate cycle (TCA cycle)
pmon00620  Pyruvate metabolism
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01120  Microbial metabolism in diverse environments
pmon01130  Biosynthesis of antibiotics
pmon01200  Carbon metabolism
Module
pmon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pmon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X969_06480
   00620 Pyruvate metabolism
    X969_06480
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     X969_06480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_oxidored DUF3768
Motif
Other DBs
NCBI-ProteinID: AHC81632
Position
1386879..1388453
Genome map
AA seq 524 aa AA seqDB search
MKKFLLTFLCLGVIGCSKPAEPEKTVDVLLIGGGIMSASLGTYLTELEPSWKIDVYERLD
QVAEESSNAWNNAGTGHSAFCELNYTSVGKDGNIDISKAVGVNEQFEVSKQFWAYQVEQG
VLSNPKSFINNVPHMSFVWGDDNVAFLHKRVDALQHSSLFRGMEISEDHEQIRKWAPLVM
EGRDPGQKVAATRMAIGTDVNFGEITRQLFAAMTRNPNVSLNLRHEVRDIVRNDDGTWHV
RVLDLANGGEEKAVNARFVFIGAGGGALKLLQKSGIPEAEGYAGFPVGGQFLMTDNPDLV
ARHQAKLYGKASVGAPPMSVPHLDTRMIDGKQVLLFGPFATFSTKYLKHGSLLDMFASLN
SHNVLPMVNAGIDNIDLSTYLMGQLMLSFDDRMNALREYFPNAKNEDWKLLQAGQRVQVI
KKDPVLGGVLQFGTEVVAAQDGSIAALLGASPGASTAAPIMLTVLEKTFKDRIQSPAWQA
RLKEIVPSYGQKLNNNLALTNQTRAWSSERLQLLYVPVEAEVSH
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaattcctgctgacgttcctctgcctgggcgtcatcggctgctccaaacccgcg
gaaccggaaaagaccgtcgacgtgctgctgatcggcggtggcatcatgagtgccagcctg
ggtacctacctcaccgagctggagccctcctggaagatcgacgtctatgagcgcctggac
caggtggccgaagaaagctccaatgcctggaacaacgccggcaccggtcactccgcgttc
tgcgagttgaactacaccagtgtgggcaaggacggcaatatcgatatcagcaaggccgtt
ggggtcaacgagcagttcgaggtgtccaagcagttctgggcctaccaggtcgagcagggc
gtgctgagcaacccgaagtcgttcatcaacaacgtgccgcacatgagttttgtctggggt
gacgacaacgtcgccttcctgcacaagcgcgtcgacgccctgcagcacagctcgctgttc
cgcggcatggaaatctcggaagaccacgagcagatccgcaagtgggcgccgctggtgatg
gagggccgtgacccggggcagaaggtcgccgccacgcgcatggccatcggtaccgacgtg
aactttggcgaaatcacccgccagttgttcgccgcgatgacccgcaaccccaatgtgtcg
ctgaacctgcgtcatgaggtgcgtgacatcgtgcgcaacgacgacggcacctggcatgtg
cgggtgctcgatctggccaacggcggcgaggaaaaggccgtcaacgcccgcttcgtgttc
atcggtgccggtggtggcgcgctgaagctgctgcagaagtcgggcattcctgaagccgaa
ggctacgccggcttcccggtcggtggtcagttcctgatgaccgacaaccccgacctggtc
gcccgccaccaagccaagctgtacggcaaggcctcggttggcgcgccgccgatgtcggta
ccgcacctggacacgcggatgatcgatggcaagcaggtgctgctgttcggcccgttcgcc
accttctccaccaagtacctcaagcacggctcgctgctggacatgttcgcctcgctgaac
agccacaacgtgctgccgatggtcaatgccggtatcgataacatcgacctcagcacctac
ctgatggggcagctgatgctcagtttcgatgaccgcatgaacgcgctgcgcgagtacttc
cccaacgccaagaacgaagactggaagttgctgcaggccggccagcgggtgcaggtgatc
aagaaggacccggtcctgggcggtgtgctgcagttcggtactgaagtggtggcggcgcag
gacggcagcatcgctgcgttgctgggagcttcgccgggtgcctcgacagcggcgccgatc
atgctgaccgtgctggaaaagaccttcaaggaccgtatccagtcgccagcctggcaggcc
aggctcaaggaaatcgtgccgagctatgggcaaaagctgaacaacaacctggcgctgacc
aaccagacccgggcatggagcagcgagcgcctgcagttgctgtatgtgccggtggaggcc
gaggtgtcgcactga

DBGET integrated database retrieval system