KEGG   Pseudomonas monteilii SB3078: X969_06970Help
Entry
X969_06970        CDS       T02972                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00071  Fatty acid degradation
pmon00072  Synthesis and degradation of ketone bodies
pmon00280  Valine, leucine and isoleucine degradation
pmon00310  Lysine degradation
pmon00362  Benzoate degradation
pmon00380  Tryptophan metabolism
pmon00620  Pyruvate metabolism
pmon00630  Glyoxylate and dicarboxylate metabolism
pmon00640  Propanoate metabolism
pmon00650  Butanoate metabolism
pmon00900  Terpenoid backbone biosynthesis
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01120  Microbial metabolism in diverse environments
pmon01130  Biosynthesis of antibiotics
pmon01200  Carbon metabolism
pmon01212  Fatty acid metabolism
pmon02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    X969_06970
   00630 Glyoxylate and dicarboxylate metabolism
    X969_06970
   00640 Propanoate metabolism
    X969_06970
   00650 Butanoate metabolism
    X969_06970
  09103 Lipid metabolism
   00071 Fatty acid degradation
    X969_06970
   00072 Synthesis and degradation of ketone bodies
    X969_06970
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X969_06970
   00310 Lysine degradation
    X969_06970
   00380 Tryptophan metabolism
    X969_06970
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X969_06970
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X969_06970
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    X969_06970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmon04147]
    X969_06970
Enzymes [BR:pmon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X969_06970
Exosome [BR:pmon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X969_06970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AHC81727
Position
1501660..1502853
Genome map
AA seq 397 aa AA seqDB search
MTLANDPIVIVSAVRTPMGGLQGDLKSLTAPQLGSAAIRGAVERAGIDAASVEQVLFGCV
LPAGQGQAPARQAALGAGLDKHTTCTTLNKMCGSGMQAAIMAHDLLLAGTADVVVAGGME
SMTNAPYLLDKARGGYRMGHGRIIDHMFMDGLEDAYDKGRLMGTFAEDCAQANAFSREAQ
DQFAIASLTRAQDAIKSGRFAAEIVPVEVTEGKEKRVIKDDEQPPKARLDKIPQLKPAFR
EGGTVTAANSSSISDGAAALVLMRRSEADKRGLKPLAVIHGHAAFADTPALFPTAPIGAI
DKLMKRTGWNLAEVDLFEINEAFAVVTLAAMKHLDLPHDKVNIHGGACALGHPIGASGAR
ILVTLLSALRQNNLRRGVAAICIGGGEATAMAVECLY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcgccaatgacccgatcgttatcgtcagcgccgtgcgcacgcccatgggcggc
ctgcagggcgacctcaagagcctgaccgcgccgcagctgggcagcgccgccatccgtggt
gccgtggagcgtgctggcatcgatgctgccagtgtcgagcaggtgctgttcggctgcgtg
ctgccggcaggccaaggccaggcaccggcgcgccaggccgcgctgggcgccgggctggac
aagcacaccacctgcaccaccctgaacaagatgtgcggttcgggcatgcaggcggcgatc
atggcccatgacctgctgctggccggcactgccgatgtggtggtggccggtggcatggaa
agcatgaccaacgccccgtacctgctggacaaggcccgtggcggctaccgcatgggccac
ggcagaatcatcgaccacatgttcatggacggcctggaagacgcctacgacaagggccgc
ctgatgggcacctttgccgaagactgtgcccaggccaatgccttcagccgcgaagcccag
gaccagttcgccatcgcctcgctgacccgcgcccaggacgctatcaagagtggtcgcttt
gctgccgagatcgtgccggtcgaggttaccgagggcaaggagaagcgcgtcatcaaggac
gacgaacaaccgcccaaggcgcgcctggacaagatcccgcagctcaagccggccttccgc
gaaggcggcacggtgaccgccgccaactccagctcgatttccgacggtgctgcggcgctg
gtgctgatgcgccgctccgaagccgacaagcgcggcctcaagccgctggcggtgatccac
ggccacgccgcctttgccgacaccccggcactgttcccgaccgcgccgatcggtgccatc
gacaagctgatgaaacgcactggctggaacctggccgaggtcgacttgttcgagatcaac
gaggctttcgccgtggtcaccctggcggccatgaagcacctcgacctgccgcacgacaag
gtcaatatccatggcggcgcctgcgccctcggccacccgatcggcgcttccggcgcgcgc
atcctggtgaccctgctgtcggccctgcgccagaacaacctgcgccgtggcgtggcggcc
atctgcattggcggtggcgaggccacggccatggctgtcgaatgcctgtactga

DBGET integrated database retrieval system