KEGG   Pseudomonas monteilii SB3078: X969_09520Help
Entry
X969_09520        CDS       T02972                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00561  Glycerolipid metabolism
pmon00640  Propanoate metabolism
pmon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    X969_09520
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    X969_09520
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     X969_09520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AHC82197
Position
complement(2046627..2047718)
Genome map
AA seq 363 aa AA seqDB search
MNLVFGSPGRYVQGPDVLDEAGQYLAHCGRRAVVVIDSFVIGLVKERLDATCARADVQLH
YITFDGEITAKGIAGLRQSAARFDFDVVLAVGGGKSIDAGKALAHTCGAALVNMPTVASN
DAPTSKNFVVYDEHHQLSEVGHLLSSPRYVLVDTRLIAQAPRPFLLAGIADALTKKFEAE
QCLKAGGVNMFGARPSIAGVTLARECYTVLRAHAEEGLALAGSGQVNEAFERLIEAVLLM
SGLGFESGGLSIAHAMTRGLSKIPGARDQVHGWQVAYGLLVQLVLEDREAAFMAELLAFY
RRIGLPCNLAELGVTGVDDAILLKVAEPTLQAPHARNFVRGNGQPLHSGELIEAMRALES
LTR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatctggtattcggctcacccgggcgctatgtgcaaggccccgatgttcttgacgag
gcaggccagtacctggcccattgcggccgccgagccgtggtggtcatcgacagcttcgtg
atcggcctggtcaaggagcgcctcgacgccacctgcgctcgcgccgatgtgcaactgcac
tacatcaccttcgatggcgaaatcaccgccaagggcatcgccggcctgcgccaatcggcc
gcgcgcttcgacttcgacgtggtcctggcggtcggtggcggcaaatcgatcgatgccggc
aaggcgttggcccacacctgcggtgcggcgctggtgaacatgcccacggttgcctccaac
gatgcgcctacttcgaaaaatttcgtggtatacgacgagcatcaccaactcagcgaagta
ggccacctgctcagcagcccacgctatgtcctggtcgacacccgcctgatagcccaggcc
ccgcgccccttccttctggccggcatcgccgacgcactgaccaagaagttcgaagccgag
caatgcctcaaagccggcggcgtgaacatgtttggcgctcgcccgtcgattgccggggtc
accctggcccgcgaatgctataccgtgctgcgcgcccatgccgaagagggcctggcgctg
gccggcagcggccaggtcaacgaagcgttcgaacgcctgatcgaagccgtgctgctgatg
agcggcctgggcttcgagagtggcggcctgtccatcgcccacgcgatgacccgtggcctg
tcgaagatccccggtgcccgcgaccaggtgcatggctggcaggttgcctatggtctgttg
gtgcaactggtacttgaagaccgcgaagcggcgttcatggccgaattgctggccttctac
cgacgcatcgggctgccctgcaacctggccgaactgggtgtgacgggcgtcgacgacgcc
atcttgctcaaggtcgccgaacccaccctgcaagccccccacgcacgcaacttcgtgcgt
ggcaacggccaacccctacacagcggtgaactgatcgaagccatgcgcgcactcgaatcc
ctgacccgctga

DBGET integrated database retrieval system