KEGG   Pseudomonas monteilii SB3078: X969_10925
Entry
X969_10925        CDS       T02972                                 

Definition
(GenBank) 2-hydroxy-6-oxo-2,4-heptadienoate hydrolase
  KO
K10702  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase [EC:3.7.1.25]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00622  Xylene degradation
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
pmon01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00622 Xylene degradation
    X969_10925
Enzymes [BR:pmon01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.25  2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
     X969_10925
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 BAAT_C Ndr Abhydrolase_3 Abhydrolase_4 Palm_thioest
Other DBs
NCBI-ProteinID: AHC82457
Position
2322058..2322888
AA seq 276 aa
MTNVNAEIGRMVLAGGIETNLHDVGAGNPVVLVHGSGPGVTAWANWRTVMPELSRHRRVI
APDMVGFGFTQRPHGIHYGVESWVAHLAGILDALELDRVDLVGNSFGGALSLAFAIRFPH
RVRRLVLMGAVGVSFELTDGLDAVWGYEPSVPNMRKVMDYFAYDRSLVSDELAELRYKAS
TRPGFQEAFASMFPAPRQRWVDALASSDQDIRDIRHETLILHGRDDRVIPLETSLRLNQL
IEPSQLHVFGRCGHWVQIEQNRGFIRLVNDFLAAED
NT seq 831 nt   +upstreamnt  +downstreamnt
atgacgaatgtaaacgcagagatcggccgcatggtgctggctggtggaatcgagaccaat
ctccatgatgttggcgccggcaaccctgtggtactcgttcatggttcaggcccaggtgtg
accgcctgggcgaactggaggacggtcatgcctgagttatccaggcatcgccgcgtcatt
gcgccggacatggtgggcttcggtttcacacagcggccgcacgggattcactacggcgtc
gagtcctgggttgcacatctggctgggatccttgatgccctggaactcgaccgtgtcgat
ctcgtggggaattcgttcggcggtgccttgtctctggcctttgctatccgatttccgcat
cgggttcgccgcctggtgctgatgggtgccgttggcgtgagcttcgagctcacggatgga
ctggatgcagtttggggttatgagccgtccgtgccgaacatgcgcaaggtcatggactac
ttcgcctacgaccgaagtctcgtttccgacgaactggcggaactgcgctacaaggcgagc
acccggcccggttttcaggaggccttcgcttccatgttccctgctccgcggcagcgctgg
gtagatgcgctggccagttccgatcaggacatccgggacatccggcatgaaacgctgatc
ctgcatggccgcgacgatcgcgtgattcccctcgaaacctcgttgcggctgaaccagctg
atcgaaccctcccagttacatgtctttggcaggtgtggccattgggtgcagatcgagcaa
aaccggggctttatccgcttggtcaacgattttcttgccgcggaggactga

DBGET integrated database retrieval system