KEGG   Pseudomonas monteilii SB3078: X969_14285Help
Entry
X969_14285        CDS       T02972                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00330  Arginine and proline metabolism
pmon00360  Phenylalanine metabolism
pmon00380  Tryptophan metabolism
pmon00627  Aminobenzoate degradation
pmon00643  Styrene degradation
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    X969_14285
   00360 Phenylalanine metabolism
    X969_14285
   00380 Tryptophan metabolism
    X969_14285
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    X969_14285
   00643 Styrene degradation
    X969_14285
Enzymes [BR:pmon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     X969_14285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHC83059
Position
2993568..2995271
Genome map
AA seq 567 aa AA seqDB search
MIEVTEVSIAELRDALESGRTTAVELVQAYLARIDAYDGADTATALNAVVVRNPEALNEA
AASDARRAKGQVLSPLDGIPYTAKDSYLVKGLTAASGSPAFKDLVAQRDAFTIERLRAAG
AVCLGKTNMPPMANGGMQRGVYGRAESPYNANYLTAPFASGSSNGAGTATAASFSAFGLA
EETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYARTMADLLEILDVVVA
DDADKRGDLWRLQPWVPIPAASTVRPASYLDLAVDASALKGKRFGVPRMYINADAEAGTS
EKPGIGGPTGQRIQTRATVIDLWQQARQALEAAGAEVLEVDFPLVSNCEGDRPGAPTVYN
RGIVSKEFLHDELWELSGWAFDDFLRANDDPRLNRLADVDGPQIFPHDPGTLPNREDDLA
AGMDEYVNMAKRGLKTWDQIETLPDGLRGLEQTRKIDLEDWMDKLGLDAVLFPTVADVGP
ADADVNPASADIAWSNGIWVANGNLAIRHLGVPTVTVPMGVMADIGMPVGLTFAGRAYSD
NALLSFGAAFEATGSRRMIPPRTPPLG
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggtaaccgaggtttccattgccgagctgcgcgatgcgctcgagtcgggccgc
acgacggcggtcgagctggtccaggcctacctggcgcgcatcgacgcctacgatggcgcc
gacaccgccaccgccctgaacgccgttgtggtacgcaaccccgaggcgctgaatgaggcc
gcagcctccgacgcccgtcgcgccaaaggccaggtcctgagcccgctggacggcatcccc
tacaccgccaaggacagctacctggtcaaaggcctgaccgctgcctccggcagccctgcc
ttcaaggacctggtggcccagcgcgacgccttcaccatcgaacgcctgcgcgccgccggc
gccgtgtgcctgggcaagaccaacatgccgcccatggccaacggcggcatgcagcgcggc
gtgtatggccgcgccgaaagcccatacaacgccaactacctgaccgcaccgttcgcctcg
ggctcgtccaacggtgccggcaccgccactgccgccagtttcagtgccttcggcctggcc
gaagaaacctggtccagcggccgtggcccggcatccaacaatggcctgtgcgcctatacc
ccgtcgcgtggggtgatttcggtgcgtggcaactggccgctcacaccgaccatggacgtg
gtggttccctatgcccgtaccatggccgacctgctggaaatcctcgacgtggtcgtagcc
gacgacgccgacaagcgcggcgacctgtggcgcctgcaaccctgggtgccaatcccggcc
gcttctacggtgcgcccggcttcgtatctggacctggccgtggatgccagcgcgctcaag
ggcaagcgctttggcgtgccacgcatgtacatcaatgccgatgccgaagcaggtacttcc
gagaagccaggcatcggcggcccgactggccagcgcatccaaacccgcgccacggtgatc
gacctgtggcagcaggcccgccaggcactggaggcggctggtgccgaagtactggaagtg
gacttcccgctggtatccaactgcgaaggtgaccgccctggcgcaccgaccgtgtacaac
cgcggcatcgtcagcaaggaattcctgcatgacgagctgtgggagctgtcgggctgggcc
ttcgacgacttcctgcgcgccaacgatgaccccaggctcaaccgcctggccgatgtcgac
gggccgcagatcttcccccacgacccgggcaccctgcccaaccgtgaggacgacctggcc
gctggcatggacgagtacgtcaacatggccaagcgtggcctgaagacctgggaccagatc
gagaccctgcccgacggcctgcgcggcctggagcagacccgcaagatcgacctggaagac
tggatggacaagctgggcctggacgcggtgctgttccccaccgtggccgacgtgggcccg
gcggatgccgacgtcaacccggcgtcggcggacatcgcctggagcaacggtatctgggtg
gccaacggcaacctggcaatccgtcacctgggcgtgcctaccgtgaccgtgccgatgggc
gtgatggccgatatcggcatgccggtggggctgacctttgctggccgggcttacagcgac
aatgcgctgctcagctttggtgcagccttcgaggcgaccgggtcgcgtcgaatgatcccg
ccgcgtaccccgcccctgggctga

DBGET integrated database retrieval system