KEGG   Pseudomonas monteilii SB3078: X969_19895
Entry
X969_19895        CDS       T02972                                 

Definition
(GenBank) para-nitrophenol 4-monooxygenase
  KO
K18276  6-hydroxy-3-succinoylpyridine 3-monooxygenase [EC:1.14.13.163]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00760  Nicotinate and nicotinamide metabolism
pmon01100  Metabolic pathways
pmon01120  Microbial metabolism in diverse environments
Module
pmon_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    X969_19895
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.163  6-hydroxy-3-succinoylpyridine 3-monooxygenase
     X969_19895
SSDB
Motif
Pfam: FAD_binding_3 DAO Lycopene_cycl HI0933_like Pyr_redox_2 NAD_binding_8 FAD_binding_2 Pyr_redox Pyr_redox_3 Trp_halogenase NAD_binding_7 Thi4 FAD_oxidored UDPG_MGDP_dh_N Glu_dehyd_C GIDA TrkA_N SE
Other DBs
NCBI-ProteinID: AHC84114
Position
complement(4203977..4205158)
AA seq 393 aa
MSMKQRVIIVGGGPVGLLTALGLAKAGTNVVVLEAESQPSDSPRALVYHFPVLPHLKRLG
VLDDCVAAGLMRQNFAWRVHSTSEMIFWDLSCLEGDVELPYALHLGQDKLSRILIEHLKA
LPNVEVRYSSPVVDCEVGPRSVRVVLGGESPGVIVEGDWLIGADGANSFVRREVLNQNFF
GITWPQRYVATNTRFDFDKLGFGKTTMQVDDVYGSVICNIDADSLWRVTFMEDPNLPMEG
IRGRIDQVFKELLPTNDPYEVVAFSPYRMHQRVTDRMRNGRVILIGDAAHVTNPTGGLGL
TGGMFDAFALTSVLNQVIHDGRSEDILDVFEADRRRKFIELVSPRASDNLRNLYHQKPGE
GKNDWVNNTRSISKDIDRMRDALRFPETMETFL
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagcatgaaacagcgcgtaattatcgtaggaggggggccggtagggctgctgactgcc
ttgggcctagcaaaggcggggacaaatgtggtggtgctggaagctgagagccaacccagc
gatagtccgcgcgcgctcgtttatcattttccggtactgccacacctgaagcggttgggc
gtgcttgatgactgcgtcgcggctggtttaatgaggcagaattttgcatggcgcgttcac
tctaccagtgaaatgatcttctgggacctcagttgtcttgagggcgatgttgaattgcct
tacgcgctgcatttgggtcaggacaagctttccaggatactaatcgagcatctcaaagcc
ttgccgaatgttgaagtgcgatactcatcgccagtcgttgattgcgaagtgggcccgcgg
tctgttcgggtagttcttgggggcgagtcgccgggcgtgattgtcgaaggggattggtta
atcggagctgatggcgctaatagcttcgtgcgtcgagaggttttgaatcaaaatttcttt
ggcataacttggccgcaacgatatgtagctacaaataccaggttcgactttgacaagctt
ggttttggaaaaactactatgcaagtggacgacgtgtatggatctgtaatatgcaatatc
gatgctgattctctatggcgggtcactttcatggaagatccgaacttgcctatggaaggc
attcgtgggcgcatcgatcaagtgtttaaagagttgttgccgacgaacgatccatacgaa
gtagtcgccttctcaccatatagaatgcaccagcgcgttacggatagaatgcgcaatggt
cgtgtgatccttataggtgatgctgcacacgtaaccaacccaactggagggcttggtttg
acggggggcatgttcgacgcctttgcactaacatcggtgttgaatcaggtcatacacgac
ggtcgtagtgaagacattctcgacgtgttcgaagccgaccgccgacggaaatttattgaa
ctggtatcacctagagcaagcgacaatttgcgtaatttatatcatcagaagcctggtgaa
ggaaaaaatgactgggtaaacaacactagaagcatttcaaaggatatagataggatgcgc
gatgctttacgttttccagagactatggaaacctttctgtag

DBGET integrated database retrieval system