KEGG   Pseudomonas monteilii SB3078: X969_23840Help
Entry
X969_23840        CDS       T02972                                 

Definition
(GenBank) amine oxidase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00260  Glycine, serine and threonine metabolism
pmon00330  Arginine and proline metabolism
pmon00340  Histidine metabolism
pmon00350  Tyrosine metabolism
pmon00360  Phenylalanine metabolism
pmon00380  Tryptophan metabolism
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmon00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    X969_23840
   00330 Arginine and proline metabolism
    X969_23840
   00340 Histidine metabolism
    X969_23840
   00350 Tyrosine metabolism
    X969_23840
   00360 Phenylalanine metabolism
    X969_23840
   00380 Tryptophan metabolism
    X969_23840
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     X969_23840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 Pyr_redox_2 FAD_oxidored HI0933_like Pyr_redox Thi4 Pyr_redox_3 GIDA FAD_binding_3 DUF2076 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHC84866
Position
complement(5079145..5081010)
Genome map
AA seq 621 aa AA seqDB search
MAAAWVRLCALVLIGVSSGAALAKDKTPSAIVVGGGLAGLTAAYELQNKGWQVTLLEAKP
GMGGRSGLATSEWIGNAKAQPVLNQYLDRFKLETLPAPEFVRTPGYLIDGEYFSATDLAT
KQPATAEALKRYEKTLDDLARSIEDPLNPQANSTLFALDQINVSTWLDKLQLPTTARQLV
NQQIRTRYDEPSRLSLLYFAQQNRVYRGVSDRDLRAARLPGGSPVLAQAFVKQLKTIKTS
SPVTSIVQDKDGVTVKVGSVGYQADYLVMAVPLRALAKIQMTPGLDSQHLAALKGTNYGW
RDQLMLKFKKPVWESRARMSGEIFSNAGLGMLWIEPALKGGANVVINLSGDNARLLQAFG
DKQMVDQVLIRLHAFYPQARGSFTGYEVKRYSTDAGTGGAYLAYGPGQISKYWRLWERPV
QRITFAGEHTDALYPGTLEGALRSGQRAASQVQDLLAGKSFDPAKAAPVAAAAAAGAVAA
KESKGGFFSNMFGGSSDKGDKADKAPVKAEPKPVDEAKQDKPGFFKRLFGGADKPEVKAE
PIAKAEEVAPAPAPAPQAAPAPVAPALVVKEAATKPAATKAASGKHAPAHKPTHKPAETK
KATAKSEPAKKAVANTQAKAG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcttgggtgcgcctgtgcgcgttggtattgattggtgtgtccagcggcgcc
gcgctggcaaaggacaagacaccttcggcgatcgtcgtgggtggcggcctggcgggcctg
acggccgcctacgagctgcagaacaaaggctggcaggtgacgctgctggaagccaagccg
ggcatgggcgggcgctctggcctggctaccagtgagtggatcggcaacgccaaggcgcag
ccggtgctcaaccagtacctcgaccgtttcaaacttgaaacactgccggcaccggagttc
gtgcgtacccccggttacctgattgacggcgagtatttcagtgccaccgacctggctacc
aagcagccggccaccgccgaggcgctcaagcgttacgagaaaaccctcgatgacctggcc
cgttcgatcgaagacccgctgaacccgcaagccaacagcacgctgttcgccctcgaccag
atcaacgtctccacctggctggacaagctgcagctgccgaccaccgcccgccagctggtc
aaccagcagatccgtacccgctacgatgagccatcgcgcctgtcgctgctgtattttgcc
cagcagaaccgcgtgtatcgtggcgtcagcgaccgtgacctgcgtgccgcgcgcctgccc
ggtggcagcccggtactggcccaagcgttcgtcaagcaactgaagacgatcaagaccagt
tcacccgtgacctccatcgtccaggacaaggacggtgtcacggtcaaggtcggcagcgtc
ggctaccaggcggattacctggtcatggccgtgcccctgcgcgccctggccaagatccag
atgaccccgggcctggacagccagcacctggcggcgttgaagggtaccaactatggctgg
cgcgaccagctgatgctcaagttcaagaagccagtgtgggaaagccgggcgcgcatgtcg
ggcgaaatcttcagtaacgcaggcttgggcatgctgtggatcgaacccgcgctcaagggt
ggcgccaacgtggtgatcaacctgtcgggcgacaacgcccgcctgctgcaggcgttcggt
gacaagcagatggtcgaccaggtgctgatccgcctgcatgcgttctacccgcaggcccgt
ggttcgttcaccggctacgaggtcaagcgctacagcaccgacgccggtaccggcggcgcc
tacctggcctacggcccggggcagatcagcaagtactggcgcctttgggagcgtccggtg
cagcgcatcacctttgccggtgagcataccgacgccctctacccgggcactctggaaggc
gccctgcgcagtggccagcgcgcggccagccaggtgcaggacctgctggccggcaagtcg
ttcgacccggccaaggcggcaccagtggcggcggcggcagctgcaggcgccgtggcggcc
aaggagagcaagggcgggttcttctccaacatgttcggtggttcttccgacaagggcgac
aaggctgacaaggccccggtcaaggccgagccgaagccggtcgatgaggccaagcaggat
aagccgggcttcttcaagcgcctgtttggcggggcggacaagcctgaggtgaaggccgag
ccgattgccaaggccgaggaagtggcgcctgcgccagccccagccccgcaagcagcgccg
gccccggttgcgccagcgcttgtggtcaaggaagcagcgaccaagcctgctgcgaccaag
gctgcatctggcaagcatgcaccggcgcacaaaccgacccacaagcctgccgagaccaag
aaagcgactgccaagtccgaaccggccaagaaagctgtagccaatacccaagccaaggcc
ggttga

DBGET integrated database retrieval system