KEGG   Pseudomonas monteilii SB3078: X969_24395Help
Entry
X969_24395        CDS       T02972                                 

Gene name
metX
Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00270  Cysteine and methionine metabolism
pmon00920  Sulfur metabolism
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    X969_24395 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    X969_24395 (metX)
Enzymes [BR:pmon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     X969_24395 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     X969_24395 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AHC84971
Position
5221937..5223076
Genome map
AA seq 379 aa AA seqDB search
MSTVFPEDSVGLVVPQTARFDEPLALACGRSLASYELVYETYGTLNASASNAVLICHALS
GHHHAAGYHAATDRKPGWWDSCIGPGKPIDTNRFFVVSLNNLGGCNGSTGPSSINPATGK
PYGADFPVLTVEDWVHSQVRLAERLGIQQWAAVVGGSLGGMQALQWTISYPERVRHCVDI
ASAPKLSAQNIAFNEVARQAILTDPEFHGGSFQDQGVIPKRGLMLARMVGHITYLSDDSM
GEKFGRELKSDKLNYDFHSVEFQVESYLRYQGEEFSGRFDANTYLLMTKALDYFDPAAAQ
GGDLAATLAHVKADYCIMSFTTDWRFSPARSREIVDALMAARKNVCYLEIDSPYGHDAFL
IPTPRYMQGFSNYMNRIAI
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgtctttcccgaagattccgtcggtctggtagtaccgcaaaccgcccggttc
gatgaaccgctggccctggcctgcggccgctccctggccagttacgaactggtctacgag
acctatggcaccctgaacgccagcgcgagcaacgccgtgctgatctgccatgccctctcc
ggccaccaccatgccgctggctaccatgccgccaccgaccgcaagccgggctggtgggac
agttgtatcggccctggcaagccgatcgacaccaaccgcttcttcgtggtcagcctgaac
aacctgggcggctgcaacggcagcaccggccccagcagcatcaacccggccaccggcaag
ccctacggcgccgacttcccggtgctgaccgtggaagactgggtgcacagccaggtgcgc
ctggccgagcgcctgggcatccagcagtgggccgccgtggtcggtggcagcctgggtggc
atgcaggcgctgcagtggaccatcagctaccccgagcgcgtgcgccattgcgtcgacatc
gcctcggcgcccaagctgtcggcacagaacatcgctttcaatgaagtggcacgccaggcc
atcctcaccgaccccgaattccacggcggttcgttccaggaccagggcgtgatccccaag
cgtggcctgatgctggcgcgcatggtcggccacatcacctacctgtcggatgactcgatg
ggtgaaaaattcggccgcgagctgaagagcgacaagctcaactacgacttccacagcgtc
gaattccaggtcgagagctacctgcgctaccagggcgaggagttttccgggcgcttcgac
gccaacacctacctgttgatgaccaaggcgctggactacttcgaccccgccgccgcccag
ggcggcgacctggcagccaccctggcccacgtcaaggcggattactgcatcatgtcgttc
accaccgactggcgcttctccccggcccgttcgcgcgagatcgtcgacgccctgatggcc
gcgcgcaagaatgtctgctacctggagatcgactcgccttacgggcacgatgccttcctg
atccccacgcctcgctacatgcagggtttctcgaactacatgaaccgcattgccatctga

DBGET integrated database retrieval system