KEGG   Pseudomonas monteilii SB3078: X969_25705Help
Entry
X969_25705        CDS       T02972                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pmon  Pseudomonas monteilii SB3078
Pathway
pmon00030  Pentose phosphate pathway
pmon00480  Glutathione metabolism
pmon01100  Metabolic pathways
pmon01110  Biosynthesis of secondary metabolites
pmon01120  Microbial metabolism in diverse environments
pmon01130  Biosynthesis of antibiotics
pmon01200  Carbon metabolism
Module
pmon_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pmon_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
pmon_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:pmon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    X969_25705
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    X969_25705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmon04147]
    X969_25705
Enzymes [BR:pmon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     X969_25705
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     X969_25705
Exosome [BR:pmon04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   X969_25705
  Exosomal proteins of colorectal cancer cells
   X969_25705
  Exosomal proteins of bladder cancer cells
   X969_25705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AHC85225
Position
5503387..5504829
Genome map
AA seq 480 aa AA seqDB search
MTIPCDILVFGGTGDLALHKLLPALYHLFREARLNNAVRIIALARRNLPRNDYLKLAERH
CRAQIARNDFDEEVWQRFSARVDYFAMDASQSADFGRLARYLGEPGGLTRIFYLATAPNL
FVPIAKHLHNAGLADTEARIVLEKPIGHSLESATAINEAIGAVLEENQVFRIDHYLGKET
VQNLMALRFANALLEPVWRNNQVDHVQISVCETLGVENRGAYYDRAGATRDMLQNHLLQL
LCLVAMEPPAQFEAEAVRDEKVKILRALKPITGQDVQDKTVRGQYGAGRIGGQEVPAYYF
EKDVDNDSDTETFIAIETHIDNWRWAGVPFYLRTGKRMARRSSQIVIQFKPVPHELFNGG
QVNQLLIQLQPDERISLRMMTKSPGKGMRLEPVDLDLNLAQVFSQTRRWDAYERLLLDVL
EGDSTLFMRRDEVEAAWAWIDPIIKGCEEHFQAPRPYPAGCNGPEQANSLLARHGRQWHS
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgactattccttgcgacattctggtcttcggcggcaccggcgatctggccctgcacaaa
ttgcttccggcgctctaccacctgtttcgcgaggcccgtctgaacaacgccgtgcggatc
atcgcgctggcacgacgcaacttgccacgtaacgattatctcaagctcgccgaacgccat
tgccgggcacagattgcccgcaacgacttcgacgaagaggtctggcagcggttttccgca
cgggtcgactatttcgccatggatgcttcgcaaagcgccgacttcggtcgcctggcgcgc
tacctgggcgagcccggcggcttgacgcgcatcttctacctggccaccgcccccaatctg
ttcgtgccgattgccaagcacctgcataacgccggcctggcagacactgaggcgcgcatc
gtgctggaaaagccgatcggccactcgctggaatcggctaccgccatcaacgaagcgatt
ggcgcagtgctggaggaaaaccaggtatttcgcatcgaccactacctgggcaaggaaacc
gtgcagaacctcatggccctgcgttttgccaacgccctgctggagccggtgtggcgcaac
aaccaggttgatcacgtgcagatcagcgtttgcgagaccctgggtgtagagaaccgtggt
gcttactacgaccgcgccggggcgacccgcgacatgttgcagaaccacctgcttcagctg
ctatgcctggtggccatggagccccccgcgcagttcgaggccgaagcggtgcgtgacgag
aaagtgaagatcctgcgggccctcaagcccatcactggccaggacgtgcaggacaagacc
gtacgcggccagtatggcgccgggcgcatcggcggccaggaagtgccggcctattacttc
gaaaaggacgtcgacaacgacagcgacaccgaaaccttcatcgccatcgagacgcacatc
gacaattggcgctgggcgggcgtgcccttctacctgcgtaccggcaagcgcatggcacgg
cgctcatcgcagatcgtcatccagttcaagccggtgccccacgagcttttcaatggtggc
caggtcaaccagctgctgatccagttgcaaccggacgaacgcatcagcctgcgcatgatg
accaagagcccggggaagggcatgcgcctggagcctgtggacctggacctgaacctggcc
caggtgttcagccagacccgccgctgggacgcctacgagcgcctgctgctggatgtgctg
gagggcgactcgacgctgttcatgcgccgcgatgaggtggaagcggcctgggcctggatc
gacccgatcatcaagggctgtgaagagcacttccaggcgccgcgaccgtacccggcaggc
tgtaacgggccagagcaagccaacagcctgctcgccaggcacggcaggcaatggcatagc
tga

DBGET integrated database retrieval system