KEGG   Pseudomonas mosselii: O165_009845Help
Entry
O165_009845       CDS       T03276                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmos  Pseudomonas mosselii
Pathway
pmos00071  Fatty acid degradation
pmos00072  Synthesis and degradation of ketone bodies
pmos00280  Valine, leucine and isoleucine degradation
pmos00310  Lysine degradation
pmos00362  Benzoate degradation
pmos00380  Tryptophan metabolism
pmos00620  Pyruvate metabolism
pmos00630  Glyoxylate and dicarboxylate metabolism
pmos00640  Propanoate metabolism
pmos00650  Butanoate metabolism
pmos00900  Terpenoid backbone biosynthesis
pmos01100  Metabolic pathways
pmos01110  Biosynthesis of secondary metabolites
pmos01120  Microbial metabolism in diverse environments
pmos01130  Biosynthesis of antibiotics
pmos01200  Carbon metabolism
pmos01212  Fatty acid metabolism
pmos02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O165_009845
   00630 Glyoxylate and dicarboxylate metabolism
    O165_009845
   00640 Propanoate metabolism
    O165_009845
   00650 Butanoate metabolism
    O165_009845
  09103 Lipid metabolism
   00071 Fatty acid degradation
    O165_009845
   00072 Synthesis and degradation of ketone bodies
    O165_009845
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O165_009845
   00310 Lysine degradation
    O165_009845
   00380 Tryptophan metabolism
    O165_009845
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    O165_009845
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O165_009845
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    O165_009845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmos04147]
    O165_009845
Enzymes [BR:pmos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     O165_009845
Exosome [BR:pmos04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O165_009845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIN58572
Position
complement(2074284..2075486)
Genome map
AA seq 400 aa AA seqDB search
MLDAYIFAGLRTPFGRHGGALASVRPDDLAAHVIHELLARHAIPGEAIEDVILGNTNQAG
EDSRNIARHAALLAGLPVTVPGQTVNRLCASGLAAVIDAARAVTCNEGELFVAGGVESMS
RAPFVMAKAEAAYSRELTVFDSTIGARFPNPKIVAEFGNDSMPQTGDNVAQEYGISRAEA
DVFAAGSQARYEAARSAGFFQEELLAVSVPTGRKTPPNVVEQDEHPRPQSDLIALARLNP
LSEGGVVTAGNASGVNDGAAALLIGSAAAGERHGLVPMARILSAAAVGVAPRIMGVGPVE
AIHKALARAQLSLADMDIIEINEAFASQVLGCLKGLGVAFNDPRVNPHGGAIAVGHPLGA
SGARLALSTARALQQSGKRYAVVSLCIGVGQGLAMVMERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctacatcttcgcgggactgcgcacgccatttggccgccacggcggcgca
ctcgcttcggtacgcccagacgacctcgccgcccatgtgatccacgaattgctcgctcgc
cacgccatccctggcgaagccatcgaggacgtgattctgggcaataccaaccaggcaggg
gaggacagccgcaacatcgcgcgtcacgccgcactgcttgcaggcttgcccgtgaccgta
cctgggcagacagttaaccgcctgtgcgccagtggtctggcggcggtgatcgatgccgcc
cgcgcagtgacctgtaacgaaggcgaactgtttgtcgccggcggggtggagagtatgtcc
cgtgcaccctttgtcatggctaaagcagaagcggcctatagccgcgaactgacggtgttc
gacagtaccattggcgcccgttttcccaacccgaagatcgtcgccgagtttggcaacgac
agcatgccgcaaacgggcgataacgtggctcaggagtacggcatctcccgtgctgaggcc
gacgtctttgctgccggctctcaggcccgttatgaagccgcacgtagcgcaggtttcttt
caggaagaactgctcgcggtcagcgtgcccaccgggcgcaagacgccacccaatgtggtg
gagcaggacgagcacccgcgcccgcaatcggacctgatcgctttggctcgcctgaatcct
ctctccgaaggtggtgtggttaccgccggcaacgcatcaggcgtcaacgatggcgcggcg
gcattgctgattggctcggccgcggcgggcgaacggcacggcttggttccgatggcgcgc
attctgtcggccgccgccgtgggtgtggccccgcgcattatgggcgtcggcccggtggag
gctattcataaggcattggctcgcgcgcagctcagcctggcggatatggacattatcgag
atcaacgaagcgttcgccagccaggtgctgggctgcctgaaaggtctgggtgttgcgttc
aacgacccgcgggtaaacccacacggtggcgccatcgccgtcggccacccattaggtgca
tccggtgcgcgcctggccctgagcaccgctcgcgcgctgcaacagagcggcaaacgctac
gctgtggtgagcctatgcatcggcgtgggccaaggcctcgccatggtgatggagcgtgtg
taa

DBGET integrated database retrieval system