KEGG   Pseudomonas soli: O165_014015Help
Entry
O165_014015       CDS       T03276                                 

Definition
(GenBank) amino acid transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
pmos  Pseudomonas soli
Pathway
pmos02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    O165_014015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmos02000]
    O165_014015
Enzymes [BR:pmos01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     O165_014015
Transporters [BR:pmos02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    O165_014015
   Histidine transporter
    O165_014015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_13 AAA_23 AAA_16 G-alpha AAA_33 AAA_25 AAA_22 RsgA_GTPase PRK AAA_24
Motif
Other DBs
NCBI-ProteinID: AIN59335
Position
2935370..2936119
Genome map
AA seq 249 aa AA seqDB search
MKLSVEGLHKHYGEHQVLKGVSLQARKGDVISLIGASGSGKSTFLRCINFLEQPNAGSIT
LDGQTLEIHPGTRTPPPAQLQNLRTRLAMVFQHFNLWSHLTVLENICLAPRKVLGVSASE
AEARARKYLDKVGLPARAAEQYPAFLSGGQQQRVAIARALAMEPEIILFDEPTSALDPEL
VGEVLKVIQTLAEEGRTMLMVTHEMGFARQVSSQVLFLHQGLVEESGSAEILDRPQSERL
RQFLSNRLK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atcaagctcagcgtcgagggcctgcacaagcactacggcgagcaccaggtgctcaagggc
gtctcgctgcaggcgcgcaagggcgacgtgatcagcctgatcggcgccagcggctcgggc
aagagcaccttcctgcgctgcatcaacttcctcgagcagcccaatgccggcagcatcacc
ctcgacggccagaccctggagatccaccccggcacccgcaccccgccgccagcccagttg
cagaacctgcgcacgcgcctggccatggtgttccagcacttcaacctgtggagccacctg
accgtgctggaaaacatttgcctggcgccgcgcaaggtgctcggagtcagcgccagcgaa
gccgaggcgcgggcgcgcaagtacctggacaaggtcggcctgccggcccgcgccgccgag
cagtatccggcgtttctctccggcggccagcaacagcgcgtggccatcgcccgggcgctg
gccatggagccggaaatcatcctgttcgacgagcccacctcggcactcgacccggagctg
gtcggcgaagtgctcaaggtgatacagacgctcgccgaggaaggacgtaccatgctcatg
gtcacccatgaaatggggtttgcccgccaggtatcgagccaggtgctgttcctgcaccag
ggcctggtcgaggaaagcggcagcgccgagatcctcgaccggccacagagcgagcgcctg
cggcagttcctctccaaccgcctcaagtga

DBGET integrated database retrieval system