KEGG   Pseudomonas soli: O165_025960Help
Entry
O165_025960       CDS       T03276                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
pmos  Pseudomonas soli
Brite
KEGG Orthology (KO) [BR:pmos00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    O165_025960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AIN61588
UniProt: A0A1H9M2N9
Position
complement(5589535..5589915)
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVVTRYLKEQSDPESSRFAFAYTITVQNNGTLKAKLMSRHWLITNGDGEV
EEVRGAGVIGQQPLIEPGQSHTYSSGAVISTRVGTMQGSYQMFAEDGKRFDAQIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacccccgctaccagatcgacgtcagcgtcgtgacccgctatctcaaagaacaa
tccgaccccgaaagcagccgcttcgccttcgcctacaccatcaccgtgcagaataacggc
acgctcaaggccaagctgatgtcccgccactggctgatcaccaacggtgacggcgaagtc
gaggaggtgcgcggtgccggtgtgatcggccaacagccgctgatcgagccaggccagagc
cacacctacagcagcggtgcggtgataagcacccgcgtcggcaccatgcagggcagctat
cagatgttcgccgaagacggcaaacgcttcgatgcccagatcgccccgttccgcctggcc
gtgcccggggcgctgcactga

DBGET integrated database retrieval system