KEGG   Pseudomonas monteilii SB3101: X970_00225
Entry
X970_00225        CDS       T02973                                 

Definition
(GenBank) 6-hydroxy-3-succinoylpyridine hydroxylase NicB
  KO
K15359  6-hydroxy-3-succinoylpyridine 3-monooxygenase [EC:1.14.13.163]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00760  Nicotinate and nicotinamide metabolism
pmot01100  Metabolic pathways
pmot01120  Microbial metabolism in diverse environments
Module
pmot_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    X970_00225
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.163  6-hydroxy-3-succinoylpyridine 3-monooxygenase
     X970_00225
SSDB
Motif
Pfam: DUF2384 NYN
Other DBs
NCBI-ProteinID: AHC85894
UniProt: V9URM7
Position
52355..53302
AA seq 315 aa
MQKMQRKLDSEPLRTRIYIDGYNFYYGCLRGTPYKWLDLLPLFEKHILPSILVTDNHGQI
RAWRLLESPSIKYFTAKIIESVARAGDSVSSQARYHTALRKLHDGRIELIEGYYAVNKMK
VKIVGPENPDKAPRECREIQAWKVEEKQSDVNLALQAYHDSITGQVDHAVIVTNDTDIAP
ALQMIRAHTDVRIGVVVPTSGQNRSANTDLIKFAHWKREHINSGELAACQLPRVIPGRKP
TIKPESWYGQPELLQEILDLAIPVRGSRAAAFKWMEQPNQFLSGERPIELVETAEGATRV
LQYIHSWIAQQEELP
NT seq 948 nt   +upstreamnt  +downstreamnt
gtgcaaaaaatgcagagaaagcttgattctgagcctctgcgcactcgtatctatatcgac
ggctacaacttctactacggctgcttgcgcggcacaccgtacaagtggctcgacctgttg
cctctctttgaaaagcacatcttgccttccatactggtcacggacaaccatggccagatc
agggcatggcggctcctggaatccccctcgatcaaatatttcacggcaaagatcatcgag
tcggtcgcccgtgctggcgattcggtgtcgtcacaagctcgctaccacaccgctttgcgc
aagctgcatgatggtcgaatagagctcatcgaaggttattacgccgtcaataaaatgaag
gtgaagatcgtcggccctgaaaatccggacaaggctccgcgtgagtgccgggaaatccag
gcctggaaggtggaggagaaacagagcgacgtgaatctggccctccaggcttaccatgat
tcgatcacggggcaggttgaccatgccgtcatcgttaccaacgatactgacatcgctcct
gcacttcagatgattcgtgctcacacagatgtgcggattggcgtggttgtgccgacgtcg
gggcaaaaccgctcggcgaataccgacctgatcaagtttgcgcactggaagcgagagcac
atcaattcaggcgagcttgcggcctgtcagctaccgagagtgattccagggaggaaacca
accatcaagccggagtcctggtatgggcaacctgaactgctgcaggaaattctggatttg
gccattcctgtacgcggaagcagggcggcagcgttcaagtggatggagcagcccaatcag
ttcctcagtggtgagcggccgatagagctggtggaaactgccgaaggtgcgacacgggtt
cttcagtacatacacagctggatagcccagcaagaggagttgccctag

DBGET integrated database retrieval system