KEGG   Pseudomonas monteilii SB3101: X970_00365Help
Entry
X970_00365        CDS       T02973                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
pmot  Pseudomonas monteilii SB3101
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    X970_00365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHC85916
UniProt: V9UT90
Position
complement(82437..82817)
Genome map
AA seq 126 aa AA seqDB search
MSDPRYKIDVSVVTRYLKEQSDPENSRFAFAYTITVQNNGSLKAKLLSRHWLITNGDGEV
EEVRGAGVVGQQPNIDPGQSHTYSSGAVISTRVGTMQGSYQMFAEDGKRFDAEIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccctcgctataaaatcgacgtcagcgtcgtgacccgctacctcaaagaacaa
tccgaccccgaaaacagtcgtttcgctttcgcctacaccatcaccgtgcagaacaatggc
tcgctgaaggccaagctgctgtcgcgccactggctgatcaccaacggtgacggcgaggtc
gaggaagtgcgtggcgccggcgtggtcggccagcagcccaacatcgacccgggccagagc
cacacctacagcagcggcgcggtcatcagcacccgcgtgggcaccatgcagggcagctat
cagatgttcgccgaagacggcaaacgcttcgatgccgagatcgcccccttccgcctggcg
gtgcccggggcactgcactga

DBGET integrated database retrieval system