KEGG   Pseudomonas monteilii SB3101: X970_01175Help
Entry
X970_01175        CDS       T02973                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    X970_01175
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     X970_01175
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     X970_01175
    1.1.1.-  
     X970_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 DAO PALP UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AHC86067
UniProt: V9UUE5
Position
complement(234917..236005)
Genome map
AA seq 362 aa AA seqDB search
MNDLSHTHMRAAVWHGRNDIRVEQVPLPADPAPGWVQIKVDWCGICGSDLHEYVAGPVFI
PVEAPHPLTGIQGQCILGHEFCGQIAKLGEGVEGFAVGDPVAADACQHCGTCYYCTHGLY
NICERLAFTGLMNNGAFAELVNVPANLLYRLPQGFPAEAGALIEPLAVGMHAVKKAGSLL
GETVVVVGAGTIGLCTIMCAKAAGAAQVIALEMSSARKAKAKEVGASVVLDPSQCDALVE
IRKLTAGLGADVSFECIGNKHTAKLAIDTIRKAGKCVLVGIFEEPSEFNFFELVSTEKQV
LGALAYNGEFADVIAFIADGRLDIGPLVTGRIGLEQIVELGFEELVNNKEENVKIIVSPG
VR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacctgagccacacccacatgcgcgccgccgtctggcatggccgcaatgatatt
cgcgtcgaacaggtgcccctgccggccgaccctgcgcccggctgggtgcagatcaaggtg
gactggtgcggcatctgcggctccgacctgcacgaatacgtcgctggcccggtattcatc
ccggtggaggcaccgcacccgctgaccggcatccagggccagtgcatcctcggccacgag
ttctgcggccagatcgccaagctgggtgaaggcgtggaaggttttgccgtcggtgacccg
gtggctgcggacgcctgccagcattgcggcacctgctactactgcacccacggcctgtac
aacatctgcgagcgcctggccttcaccggcctgatgaacaatggcgcctttgccgaactg
gtcaacgtgcccgccaacctgctgtaccggctgccgcagggtttcccggctgaggccggg
gcgctgatcgaaccgctggcggtgggcatgcatgcggtaaagaaggccggcagcctgctt
ggcgagacggtggtggtagttggagccggcactatcggtttgtgcaccatcatgtgtgcc
aaggcggcaggcgcggcgcaggtgatcgccctggaaatgtcctcggcacgcaaggccaag
gccaaagaggttggcgccagcgtggtgctggaccccagccagtgcgacgccctggtggaa
atccgcaagctcactgccgggctgggcgcggatgtgagttttgaatgcatcggcaacaag
cacacggccaagctggccatcgacaccatccgcaaggcgggcaagtgcgtgttggtgggg
atattcgaggagcctagcgagttcaacttcttcgaactggtgtccaccgaaaagcaggtg
ctgggcgcgttggcgtacaacggcgagtttgccgatgtgattgccttcatcgctgacggc
aggctggacattggcccgctggtgaccgggcggatcgggctggagcagattgtcgagctg
ggcttcgaggagttggtcaacaacaaggaggagaacgtgaagatcatcgtttcgccgggc
gtgcgctga

DBGET integrated database retrieval system