KEGG   Pseudomonas monteilii SB3101: X970_01330Help
Entry
X970_01330        CDS       T02973                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00071  Fatty acid degradation
pmot00072  Synthesis and degradation of ketone bodies
pmot00280  Valine, leucine and isoleucine degradation
pmot00310  Lysine degradation
pmot00362  Benzoate degradation
pmot00380  Tryptophan metabolism
pmot00620  Pyruvate metabolism
pmot00630  Glyoxylate and dicarboxylate metabolism
pmot00640  Propanoate metabolism
pmot00650  Butanoate metabolism
pmot00900  Terpenoid backbone biosynthesis
pmot01100  Metabolic pathways
pmot01110  Biosynthesis of secondary metabolites
pmot01120  Microbial metabolism in diverse environments
pmot01130  Biosynthesis of antibiotics
pmot01200  Carbon metabolism
pmot01212  Fatty acid metabolism
pmot02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmot00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    X970_01330
   00630 Glyoxylate and dicarboxylate metabolism
    X970_01330
   00640 Propanoate metabolism
    X970_01330
   00650 Butanoate metabolism
    X970_01330
  Lipid metabolism
   00071 Fatty acid degradation
    X970_01330
   00072 Synthesis and degradation of ketone bodies
    X970_01330
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    X970_01330
   00310 Lysine degradation
    X970_01330
   00380 Tryptophan metabolism
    X970_01330
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    X970_01330
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X970_01330
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    X970_01330
Enzymes [BR:pmot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     X970_01330
Exosome [BR:pmot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X970_01330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHC86098
UniProt: V9UVL8
Position
275006..276283
Genome map
AA seq 425 aa AA seqDB search
MRSLRRVAILGGNRIPFARSNGAYATASNQAMLTVALEGLIERYRLHGLRMGEVVAGAVL
KHSRDMNLTRECVLSSRLSPLTPAYDIQQACGTGLEAALLVANKIALGQIDCGIAGGVDT
TSDAPIAVNEGLRHILLQANRGKSLGERLKPFLKLRPHHLKPELPRNGEPRTGLSMGEHC
ERMAQAWRIGRAEQDELALLSHQALAAAYAEGWQDDLLTPFLSLTRDNNLRPDLTLEQLA
KLKPAFDRSGQGTLTAGNSTPLTDGASLVLLGSEEWAEQQGLSVLAYLVDGETAAVDFVT
GREGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLRAWEDADYCRERLGLD
APLGAIDRSKLNVKGSSLAAGHPFAATGGRILANLAKLLARSGKGRGLISICAAGGQGVT
VIVER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcacttcgccgggtcgcgatcctgggcggcaaccgaattcccttcgcccgttcc
aatggcgcctacgccacggccagcaaccaggcgatgctaaccgtcgccctcgaagggctg
atcgaacgctaccgcctgcatgggttgcgcatgggggaggtggtggctggcgctgtgctc
aagcactcgcgagacatgaacctgacacgtgagtgcgtgctgagttcgcgcctgtcgccg
ctgacgccagcctatgacatccagcaagcctgcgggacggggctagaggcggcactgctg
gtggccaataagattgccctggggcagatcgactgcggcatagccggcggtgtggacacc
acctccgatgcgccgattgcggtcaacgaaggcctgcgccacatcctgttgcaggccaac
cgtggcaagagcctgggcgaacggctcaagccatttctcaagctgcgtcctcaccacctg
aaacccgaattaccgcgcaacggtgagccgcgcaccggtttgtctatgggcgagcattgc
gaacgcatggcccaggcctggcgcattggccgtgccgagcaggacgagctggcgctgctg
agccaccaggcgctggctgccgcgtacgccgaagggtggcaggatgacctgctgacgccg
tttctgtctttgacccgtgataacaacctgcgccccgacctgacgctggaacaattggcc
aagctcaagccagccttcgaccgcagcgggcagggcacgctgacggcgggcaactccaca
ccgctgaccgatggtgcttcgctggtgttgctgggcagtgaggaatgggctgagcagcag
gggctgtcggtgctggcctatctggtcgatggtgaaaccgctgcggtggatttcgttact
ggtcgcgaagggctgttgatggcgccggtgtatgcggtgccgcggctgttggcgcgcaat
ggcctgacgctgcaggactttgactattacgagattcacgaagcctttgctgcccaggtg
ctgtgcacgctcagggcctgggaagatgccgattattgccgcgaacggctggggctggat
gcgccgctcggggcgattgaccgcagcaagctcaacgtcaagggcagttcgctggcggcc
gggcacccgtttgccgcgaccggggggcggatattggccaacctggccaagctgctggcg
aggtcggggaaggggcgggggttgatatcgatctgcgctgcgggtgggcagggggtgacc
gtcatcgtcgagcgctga

DBGET integrated database retrieval system