KEGG   Pseudomonas monteilii SB3101: X970_04505Help
Entry
X970_04505        CDS       T02973                                 

Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00860  Porphyrin and chlorophyll metabolism
pmot01100  Metabolic pathways
Module
pmot_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    X970_04505
Enzymes [BR:pmot01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     X970_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AHC86706
UniProt: V9UVM5
Position
947802..948368
Genome map
AA seq 188 aa AA seqDB search
MILDLLRHGETEQGGLRGSLDDALTDKGWAQMRQAVAEAGPWEVLVSSPLQRCACFAEEL
GERLNLPVQREAALQELHFGDWEGRSAAQIMEDQADALGRFWADPYAFTPPNGEPVEAFA
ERVLAAVERLSQQHAGKRVLLVTHGGVMRLLLARARGLPRAQLLQVEVGHAALMRLVPGD
DGQWVEGR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcgacctgctgcgccatggcgaaacggaacagggcggcctgcgtggcagcctt
gatgatgccttgaccgacaagggctgggcgcagatgcgtcaagccgtggccgaagccggc
ccgtgggaggtgctggtcagttcgccgctgcagcgctgtgcgtgttttgccgaggaactg
ggcgagcggctgaacctgcctgtgcagcgcgaagcggcattgcaggagctgcattttggc
gactgggagggccgtagtgcggcgcagatcatggaagaccaggcggacgcgctggggcgc
ttctgggcggacccttacgcgtttacaccgcccaatggcgagccggtcgaggcgttcgcc
gagcgtgtgctggcggctgtcgagcgcctgagccagcagcatgctggcaagcgtgtgctg
ctggtcacccatggcggcgtgatgcggctgctgctggcccgtgcccgtggtttgccaagg
gcgcagttgctgcaggtcgaagtcggccacgctgcgctcatgcgattggtgccgggtgac
gacggccagtgggtcgaggggcgctga

DBGET integrated database retrieval system