KEGG   Pseudomonas monteilii SB3101: X970_09195Help
Entry
X970_09195        CDS       T02973                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00561  Glycerolipid metabolism
pmot00640  Propanoate metabolism
pmot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    X970_09195
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    X970_09195
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     X970_09195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK
Motif
Other DBs
NCBI-ProteinID: AHC87578
UniProt: V9UZT1
Position
2000858..2002054
Genome map
AA seq 398 aa AA seqDB search
MTQIFAAPGRYIQGYKELERLYRHIAWFGQRFLIITSQGRLDSLQQTLAISFDKPEHALR
YAVFEGEVTRAEVQRLCALRERLGCDGVVGVGGGKVLDAAKAVAQQGRLPLCIVPTVVSN
DAPTSALSVLYHPDGAFDDVLFHERSPDVVVVDTWIIAQAPVRLLVAGIGDALATYYEAR
TCVQGDHDNFLGLAGGGLQSSAGGGKPTLTSMAIAQLCHQVLQADAVQAVRACAQQQVTK
ALNRVIEANALMSGIGFESNGVATAHAVYCGFSELGPRATAYHGEYVAFGTLVMLVLEGA
PAGELDGLLRLCLAVGLPVCFADLGLADLSEQELQRVVQVAASPQQTSRVEPFDVTEWEM
RAALLAASDLGEFYKKGGSVLASSASPRLPSVIRHEQR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacccagatattcgccgcgcccggtcgctacattcagggctacaaggaacttgaacgc
ctttaccggcatatcgcctggtttggccagcgcttcctgatcatcaccagccagggccgt
ctggatagcctgcagcagaccctggccatcagcttcgacaaacctgagcatgccctgcgt
tacgccgtattcgaaggcgaagtcacccgagccgaggtgcagcggctgtgtgcgttgcgc
gagcgactgggctgtgacggggtggtcggggtgggtggtggcaaggtgctcgacgctgcc
aaggcggttgcccagcagggccggctgccgctgtgtatcgtgcccacggtggtctccaac
gatgcccccaccagcgccttgtcggtgctctaccacccggacggtgccttcgacgatgta
ctgttccacgagcgcagcccggacgtggtggtggtggacacctggatcatcgcccaagcg
ccggtgcgcctgttggtggctggcatcggcgatgctctggcgacctactacgaggcacgc
acctgcgtgcagggcgaccacgacaacttccttggcctggccggcggtggcctgcaatcg
agcgcgggcggcggcaagccgaccctcacatcgatggccatcgcccaactgtgccaccag
gttttgcaagccgatgcggtgcaagccgtgcgggcctgtgcgcagcagcaggtgaccaag
gcgctgaaccgggtgatcgaggccaacgcactgatgagcggcatcggtttcgagagcaac
ggggtggccaccgctcatgccgtgtattgcggcttcagtgagctgggtccacgggccacg
gcctaccacggcgaatacgttgcctttggcaccctggtgatgctggtgctcgagggtgcg
ccggccggtgagctggatggcctgctgcgactgtgcctggcggttggtctgccggtgtgt
ttcgccgacctgggcctggcggacctcagcgagcaggagctgcaacgggtggtgcaggtg
gcggcctcgccgcagcagaccagccgcgtcgagcccttcgacgtcactgagtgggagatg
cgcgcagcgctgcttgccgccagcgacctgggggagttctacaagaaaggcggatcggtt
ctggcaagttcggccagcccgcgtttgccatcagtcattcgccacgaacagaggtaa

DBGET integrated database retrieval system