KEGG   Pseudomonas monteilii SB3101: X970_10585Help
Entry
X970_10585        CDS       T02973                                 

Definition
(GenBank) benzene 1,2-dioxygenase
  KO
K03268  benzene/toluene/chlorobenzene dioxygenase subunit alpha [EC:1.14.12.3 1.14.12.11 1.14.12.26]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00361  Chlorocyclohexane and chlorobenzene degradation
pmot00362  Benzoate degradation
pmot00623  Toluene degradation
pmot00625  Chloroalkane and chloroalkene degradation
pmot01100  Metabolic pathways
pmot01120  Microbial metabolism in diverse environments
pmot01220  Degradation of aromatic compounds
Module
pmot_M00547  Benzene/toluene degradation, benzene => catechol / toluene => 3-methylcatechol
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    X970_10585
   00625 Chloroalkane and chloroalkene degradation
    X970_10585
   00361 Chlorocyclohexane and chlorobenzene degradation
    X970_10585
   00623 Toluene degradation
    X970_10585
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.3  benzene 1,2-dioxygenase
     X970_10585
    1.14.12.11  toluene dioxygenase
     X970_10585
    1.14.12.26  chlorobenzene dioxygenase
     X970_10585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_A Rieske
Motif
Other DBs
NCBI-ProteinID: AHC87836
UniProt: V9UYT7
Position
2274098..2275450
Genome map
AA seq 450 aa AA seqDB search
MNQTDTSPIRLRRSWNTSEIEALFDEHAGRIDPRIYTDEDLYQLELERVFARSWLLLGHE
TQIRKPGDYITTYMGEDPVVVVRQKDASIAVFLNQCRHRGMRICRADAGNAKAFTCSYHG
WAYDTAGNLVNVPYEAESFACLNKKEWSPLKARVETYKGLIFANWDENAVDLDTYLGEAK
FYMDHMLDRTEAGTEAIPGVQKWVIPCNWKFAAEQFCSDMYHAGTTSHLSGILAGLPEDL
EMADLAPPTVGKQYRASWGGHGSGFYVGDPNLMLAIMGPKVTSYWTEGPASEKAAERLGS
VERGSKLMVEHMTVFPTCSFLPGINTVRTWHPRGPNEVEVWAFTVVDADAPDDIKEEFRR
QTLRTFSAGGVFEQDDGENWVEIQHILRGHKARSRPFNAEMSMDQTVDNDPVYPGRISNN
VYSEEAARGLYAHWLRMMTSPDWDALKATR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaccgacacatcacctatcaggctgcgcaggagctggaacaccagcgagata
gaagcgctctttgacgagcatgccggacgtatcgatccgcgcatttataccgatgaggat
ctgtaccaactcgaactggagcgtgtcttcgcccggtcctggctgctgttggggcatgaa
acccagattcgcaagccgggcgattacatcacgacctacatgggtgaagaccctgtcgtg
gtcgtccggcagaaagacgccagcattgccgtgttcctgaaccagtgccgccaccgtggc
atgcgcatctgccgcgcggatgccggaaacgcgaaggcgttcacttgcagctaccacggg
tgggcttacgacaccgccggcaatcttgtcaatgtgccttacgaggccgaatccttcgcg
tgcctgaacaagaaggaatggagcccgctgaaggcccgggtagaaacctacaagggcctg
attttcgccaactgggatgagaacgctgtagacctcgacacgtatctgggcgaggcgaag
ttctacatggaccacatgctcgaccgcaccgaggccggcaccgaagcgatcccgggcgtg
cagaagtgggtcattccctgtaactggaaattcgccgcagagcagttttgcagcgacatg
taccatgccgggacgacctcgcatctgtctggcatcctggcaggcctgccagaagacctt
gaaatggccgaccttgctccgccgacagttggcaagcagtaccgtgcgtcatggggcgga
catggaagtggcttctatgtcggcgaccccaatctgatgcttgccatcatggggccaaag
gtcaccagctactggaccgaaggccccgcgtcggaaaaggcggccgaacgtctgggtagc
gtggagcgcggctcgaaactcatggtcgagcacatgaccgtcttccccacgtgttccttc
ctcccaggtatcaatacggtccggacatggcatccgcgcgggccgaacgaggtcgaggta
tgggcgtttacggtggtcgatgctgatgctcctgacgatatcaaggaagagttccggcgc
cagacgctgcgcaccttctctgccggtggcgtgttcgagcaggacgacggggagaactgg
gtcgagatccagcacatcctgcgaggccacaaggcgcggagccgccctttcaatgccgag
atgagcatggaccagaccgtcgacaacgacccggtttaccccgggcggatcagcaacaac
gtctacagcgaggaagctgcccgcgggctctatgcccattggctgcggatgatgacatcc
cccgactgggacgcgctgaaggcgacacgctga

DBGET integrated database retrieval system