KEGG   Pseudomonas monteilii SB3101: X970_19530
Entry
X970_19530        CDS       T02973                                 

Definition
(GenBank) para-nitrophenol 4-monooxygenase
  KO
K18276  6-hydroxy-3-succinoylpyridine 3-monooxygenase [EC:1.14.13.163]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00760  Nicotinate and nicotinamide metabolism
pmot01100  Metabolic pathways
pmot01120  Microbial metabolism in diverse environments
Module
pmot_M00811  Nicotine degradation, pyrrolidine pathway, nicotine => succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    X970_19530
Enzymes [BR:pmot01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.163  6-hydroxy-3-succinoylpyridine 3-monooxygenase
     X970_19530
SSDB
Motif
Pfam: FAD_binding_3 DAO Lycopene_cycl HI0933_like Pyr_redox_2 NAD_binding_8 FAD_binding_2 Pyr_redox Pyr_redox_3 Trp_halogenase NAD_binding_7 Thi4 FAD_oxidored UDPG_MGDP_dh_N Glu_dehyd_C GIDA TrkA_N SE
Other DBs
NCBI-ProteinID: AHC89485
UniProt: V9V6L7
Position
complement(4152585..4153766)
AA seq 393 aa
MSMKQRVIIVGGGPVGLLTALGLAKAGTNVVVLEAESQPSDSPRALVYHFPVLPHLKRLG
VLDDCVAAGLMRQNFAWRVHSTSEMIFWDLSCLEGDVELPYALHLGQDKLSRILIEHLKA
LPNVEVRYSSPVVDCEVGPRSVRVVLGGESPGVIVEGDWLIGADGANSFVRREVLNQNFF
GITWPQRYVATNTRFDFDKLGFGKTTMQVDDVYGSVICNIDADSLWRVTFMEDPNLPMEG
IRGRIDQVFKELLPTNDPYEVVAFSPYRMHQRVTDRMRNGRVILIGDAAHVTNPTGGLGL
TGGMFDAFALTSVLNQVIHDGRSEDILDVFEADRRRKFIELVSPRASDNLRNLYHQKPGE
GKNDWVNNTRSISKDIDRMRDALRFPETMETFL
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgagcatgaaacagcgcgtaattatcgtaggaggggggccggtagggctgctgactgcc
ttgggcctagcaaaggcggggacaaatgtggtggtgctggaagctgagagccaacccagc
gatagtccgcgcgcgctcgtttatcattttccggtactgccacacctgaagcggttgggc
gtgcttgatgactgcgtcgcggctggtttaatgaggcagaattttgcatggcgcgttcac
tctaccagtgaaatgatcttctgggacctcagttgtcttgagggcgatgttgaattgcct
tacgcgctgcatttgggtcaggacaagctttccaggatactaatcgagcatctcaaagcc
ttgccgaatgttgaagtgcgatactcatcgccagtcgttgattgcgaagtgggcccgcgg
tctgttcgggtagttcttgggggcgagtcgccgggcgtgattgtcgaaggggattggtta
atcggagctgatggcgctaatagcttcgtgcgtcgagaggttttgaatcaaaatttcttt
ggcataacttggccgcaacgatatgtagctacaaataccaggttcgactttgacaagctt
ggttttggaaaaactactatgcaagtggacgacgtgtatggatctgtaatatgcaatatc
gatgctgattctctatggcgggtcactttcatggaagatccgaacttgcctatggaaggc
attcgtgggcgcatcgatcaagtgtttaaagagttgttgccgacgaacgatccatacgaa
gtagtcgccttctcaccatatagaatgcaccagcgcgttacggatagaatgcgcaatggt
cgtgtgatccttataggtgatgctgcacacgtaaccaacccaactggagggcttggtttg
acggggggcatgttcgacgcctttgcactaacatcggtgttgaatcaggtcatacacgac
ggtcgtagtgaagacattctcgacgtgttcgaagccgaccgccgacggaaatttattgaa
ctggtatcacctagagcaagcgacaatttgcgtaatttatatcatcagaagcctggtgaa
ggaaaaaatgactgggtaaacaacactagaagcatttcaaaggatatagataggatgcgc
gatgctttacgttttccagagactatggaaacctttctgtag

DBGET integrated database retrieval system