KEGG   Pseudomonas monteilii SB3101: X970_20090Help
Entry
X970_20090        CDS       T02973                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00450  Selenocompound metabolism
pmot00970  Aminoacyl-tRNA biosynthesis
pmot01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    X970_20090 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    X970_20090 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pmot01007]
    X970_20090 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmot03016]
    X970_20090 (metG)
Enzymes [BR:pmot01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     X970_20090 (metG)
Amino acid related enzymes [BR:pmot01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   X970_20090 (metG)
Transfer RNA biogenesis [BR:pmot03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    X970_20090 (metG)
 Prokaryotic type
   Other AARSs
    X970_20090 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AHC89580
UniProt: V9V6W3
Position
4284686..4286725
Genome map
AA seq 679 aa AA seqDB search
MSEPRQILVTSALPYANGSIHLGHMLEYIQTDMWVRFQKLRGNQCIYVCADDAHGSAIML
RAEKEGITPEQLIANVQAEHSSDFADFLVDFDNFHSTHSEENRELSGLIYARLRDAGHIA
TRSVTQYFDPEKGMFLADRFIKGTCPKCAAEDQYGDNCEKCGATYAPTELKNPKSAISGA
TPVLRDSQHFFFKLPDFQAMLQQWTRSGTLQDAVANKLAEWLDSGLQEWDISRDAPYFGF
EIPGEPGKYFYVWLDAPIGYMASFKNLCARRPELDFDAFWNEGSKAELYHFIGKDIVNFH
ALFWPAMLEGAGFRKPSAVNVHGYLTVNGAKMSKSRGTFIKARTYLDHLQPEYLRYYYAA
KLGRGVDDLDLNLEDFVQKVNSDLVGKVVNIASRCAGFIHKGNEGVMVAGDAAPELTEAF
LAAAPSIADAYEGRDFGRAMREIMALADRANAWIADKAPWSLAKQEGKQDEVQAICAQGI
NLFRQLVIFLKPVLPVLAADAEAFLNVAPLTWNDHLSRLENHQLNPFKALMSRIEPAKVE
AMVAASKEDLLAAEAKAPAGNGELAKDPLSAEIEFDTFAAVDLRVALIVKAEAVPGADKL
LQLTLDIGDERRNVFSGIKSAYPDPSQLEGRLTMMVANLKPRKMRFGVSEGMVMAAGPGG
EEIYLLSPDSGAKPGQRIK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccacgtcagattctcgtcaccagcgccttgccctatgccaacggatcgatc
caccttggccatatgctcgagtacattcagacagacatgtgggtccgcttccagaagctg
cgcggcaaccagtgcatctacgtttgcgccgacgacgcccacggttcggccatcatgctg
cgcgccgagaaagaaggcatcaccccggaacagctgatcgccaacgtccaggccgaacac
agcagcgacttcgccgacttcctggtggacttcgacaacttccactccacccacagcgaa
gaaaaccgcgagctgtcgggcctgatctacgcgcgcctgcgagacgccgggcacatcgcc
acccgttcggtaacccagtatttcgacccggaaaagggcatgttcctcgccgaccgcttc
atcaagggcacctgccccaagtgcgcggccgaagaccagtacggcgacaactgcgagaaa
tgcggcgccacctacgcgcccaccgagctgaagaaccccaagtcggccatctctggtgcc
accccggtattgcgtgattcccagcacttcttcttcaagctgccggacttccaggccatg
ctgcagcagtggacccgtagcggcacgctgcaggacgcggtagccaacaagctggccgaa
tggctggactcgggcctgcaggagtgggacatctcccgcgacgcgccgtacttcggcttc
gagatcccgggcgagccaggcaagtacttctacgtgtggctggatgcaccgatcggctac
atggccagcttcaagaacctttgtgcacgccgcccggagctggacttcgacgcgttctgg
aacgaaggctccaaggccgagctgtaccacttcatcggcaaggacatcgtcaacttccac
gccctgttctggccagccatgctcgaaggcgcgggcttccgcaagccgagcgcggtcaac
gtgcacggctacctgaccgtgaacggcgccaagatgtccaagtcgcgcggtaccttcatc
aaggcccgcacctacctcgaccacctgcagccggaatacctgcgttactactacgctgcc
aagctgggccgcggtgtcgatgacctggacctgaacctggaagacttcgtgcagaaggtc
aactccgacctggtcggcaaggtggtcaacatcgccagccgctgcgccggtttcatccac
aagggcaatgaaggcgtgatggtagctggcgatgctgcaccggagctgaccgaagccttc
ctggcggccgccccgtcgatcgccgacgcctatgaaggccgcgacttcggccgtgccatg
cgcgaaatcatggcgctggccgaccgcgccaacgcctggatcgctgacaaggccccatgg
tcgctggccaaacaggaaggcaagcaggatgaagttcaggccatctgcgcccaaggcatc
aacctgttccgccaattggtgatcttcctcaagccggtgctgccggtactggctgccgac
gccgaggccttcctcaacgtggcaccactgacctggaacgaccacctgtcgcgcctggaa
aaccaccaattgaacccgttcaaggcgctgatgagccgcatcgaaccggccaaggtcgaa
gccatggtcgccgccagcaaggaagacctgctggccgccgaagccaaggccccggccggc
aatggcgagctggccaaggacccactgtcggcggaaatcgagttcgacaccttcgctgcc
gtcgatctgcgcgtggcactgatcgtcaaggccgaagccgtaccgggcgcggacaagctg
ctgcaactgaccctggacatcggtgacgagcgccgcaacgtgttttccggcatcaagtcg
gcgtaccccgacccgtcccagctggaaggccggctgaccatgatggtggccaacctcaag
ccacggaagatgcgctttggggtgtccgaagggatggtcatggcggccgggcctggcggt
gaagagatctacctgctgagcccggacagcggtgccaagccaggccagcgcatcaagtaa

DBGET integrated database retrieval system