KEGG   Pseudomonas monteilii SB3101: X970_27420Help
Entry
X970_27420        CDS       T02973                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pmot  Pseudomonas monteilii SB3101
Pathway
pmot00260  Glycine, serine and threonine metabolism
pmot01100  Metabolic pathways
pmot01110  Biosynthesis of secondary metabolites
pmot01120  Microbial metabolism in diverse environments
pmot01130  Biosynthesis of antibiotics
pmot01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmot00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    X970_27420
Enzymes [BR:pmot01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     X970_27420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHC90992
UniProt: V9V8F5
Position
complement(5912182..5913222)
Genome map
AA seq 346 aa AA seqDB search
MTDKSQQFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAAEYFRKLFETDCEVFF
AFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAPSVNGKLTPQ
SIREVALKRQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFSN
ACSFLGCSPAELTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASK
MRFLSAPWVGLLEDGAWLRHGAHANHCAQLLASLVSDLPGVDLMFPVEANGVFLQMPEHA
IEALRSRGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRAIIGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacagataagagccaacaattcgccagcgacaactattccggcatctgccccgaagcc
tgggcagcgatggaaaaggccaaccatggccacgaccgcgcctacggcgacgaccagtgg
accgaacgcgccgcggaatacttccgcaagctgttcgaaaccgactgcgaggtgttcttc
gccttcaacggcaccgccgccaactccctggcgctggcctcgctgtgccagagctaccac
agcgtgatctgctccgagaccgcccacgtcgaaaccgacgagtgcggtgcgccggagttc
ttctccaacggctccaagctgctgaccgcgcccagcgtcaacggcaagctgacaccacag
tcgatccgcgaagtggcgctgaagcgtcaggacatccactaccccaagccacgggtggtg
accattacccaggccaccgaggtgggcaccgtctatcgccccgacgagctgaaggcgatc
agcgccacctgcaaagagctggggctgaacctgcacatggacggcgcacgcttcagcaat
gcctgctcgttcctgggctgcagcccggcagagctgacctggaaggccggtgtcgatgta
ctgtgctttggcggcaccaagaacggcatggcggtgggcgaggcgatcctgttcttcaac
cgccaactggccgaggacttcgactaccgctgcaagcaggccgggcaactggcatcgaag
atgcgcttcctgtcggcgccttgggtgggcctgctggaagatggcgcctggttgcgccat
ggcgcgcatgccaaccattgcgcgcagttgctcgcctcgctggtgagtgatttgccggga
gtggatctgatgttcccggttgaggccaacggggtgttcctgcagatgccggagcatgcg
atcgaggcactgcgcagcaggggatggcggttctataccttcattggtagcggcggggcg
cggttcatgtgctcgtgggataccgaggaagagcgggtgcgcgagctggcggcggatatc
cgcgccatcatcggcgcctga

DBGET integrated database retrieval system