KEGG   Pasteurella multocida 36950: Pmu_01460Help
Entry
Pmu_01460         CDS       T01729                                 

Definition
(GenBank) putative polysaccharide biosynthesis protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt_2 Epimerase CoA_binding_3 GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind CoA_binding NAD_binding_4 Ldh_1_N TrkA_N KR adh_short
Motif
Other DBs
NCBI-ProteinID: AET15106
Position
complement(150791..152731)
Genome map
AA seq 646 aa AA seqDB search
MHYLITSLTLLSKTNKKIFLLVLDFIACPILLWQCYMLRYWSIEISVNLPFLLGISLLTV
GSLLLFGVYDFIIRSFSETLILRLGLATIITVLNLYLVTFIAEEMLPRSIPLMYGFLMFT
WIWLSRGIIRFIVKAHLTTKAPKIRIVVYGAGASGQQIISALQRSCEYLPLFFIDDNKQL
WGRTLGGFKVYSFETAMTLLKDYRVDEILIALPSVSRERRRELIKKLNKTPCKIKELPSL
QQLVDGEVGLSDIQEIAIEDLLGRDPVPPITALLNKNIQHKSVMVTGAGGSIGSELCRQI
LLNHPTKLVLFDVSEYALYSIHLELLHIQQEKGTHVEIIPLLGSVQNLKLLIKVMQTFEV
NTVYHAAAYKHVPLVEYNVIQAVYNNIFGTYNAAKAAMRCQVDAFVLISTDKAVRPTNVM
GTTKRVAELCLQACADTYGKTLDGVVHKTLFCMVRFGNVLSSSGSVIPLFKQQIKEGGPI
TVTDERIIRYFMTIPEAAQLVIQAGAMAKGGDVFILDMGEPVKILELAKKLILLSGLSIK
NENNPNGDIEIKFTGLRPGEKLYEELLIGGENVRKTLHPRILTAQETCLPFSELSLLLDE
LERACKKSDYQKIHDILRNAPTGYQPVTELADLIYTQQNNHIHLWG
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgcattatttaatcacttccttaacactgctttctaaaacgaataaaaagattttttta
ttggtgttagatttcattgcatgcccaattctgctttggcaatgttatatgctgagatat
tggagtatagaaatttcagtaaatttaccatttttattgggtatttcgttactcactgta
ggaagcctccttttgtttggtgtgtatgacttcattatccgtagttttagcgaaacgtta
attttacgcttaggtttagccaccattatcaccgtgcttaatctttatcttgtgacgttc
attgcggaagaaatgttaccgagatcgattccgttaatgtatggttttttaatgttcact
tggatttggctcagccgtggcattatacgctttatcgtaaaagcacacttaactacaaaa
gcccccaaaatacgtattgttgtttacggtgcaggcgcatcaggacaacaaattatcagc
gcactacaacgttcttgtgagtacttacctttattttttattgatgataataagcaactt
tggggaagaaccctaggtggtttcaaagtctattctttcgaaactgccatgaccttgtta
aaagactatcgtgttgatgaaatcttaattgcgcttccttctgtcagtcgggaacgtcga
agagaactcattaaaaagctgaataaaacaccttgtaaaataaaagaattgccgagctta
caacaactcgtggatggcgaagtagggctttctgacattcaagaaattgctatcgaagat
ctcttagggcgcgatccagtccccccaatcaccgctttattaaataaaaatatccaacat
aagtccgttatggtaactggcgctggcggttcaattggttccgaattatgtcggcaaatt
ctgttaaatcatccgacgaaattagtactgtttgatgtttcagaatatgccctctactct
atccatcttgagttattacatattcagcaagagaaaggaacacacgtggaaattatccca
ctgttaggctctgtacaaaatctcaagctgcttatcaaagtcatgcaaacttttgaagtt
aatacggtataccatgctgctgcgtataaacatgttccattagttgaatacaatgtcata
caagcggtatacaacaacatttttggcacatataacgcagctaaagcggcgatgcgatgc
caagtcgatgcctttgtattaatttctaccgataaagccgtaagacccacaaatgtgatg
ggcacaacaaaacgtgttgcagaattgtgtttacaagcctgtgccgatacctatggtaaa
accctagacggcgtcgtccataaaacccttttttgtatggtccgttttggcaatgtatta
agttcctcaggctctgttattcctttatttaaacaacaaattaaagaagggggaccgatt
actgtaacagacgaacgtatcatccgttatttcatgacgatccctgaagctgcacagctt
gttattcaggcaggggctatggcaaaaggaggagatgtgtttatcctcgatatgggcgaa
cccgttaagattcttgaattagcgaagaaattaattttactttccggtctcagtatcaaa
aatgaaaacaatccaaatggtgatattgaaattaaattcacgggcttacgtcccggagaa
aaactttatgaagaactcctcattggcggagaaaatgtcagaaaaacgttgcatccacga
atcctaaccgcgcaagaaacatgtcttcctttttcggagttgtccttactcttagacgaa
ttggagcgtgcatgtaaaaaatcagattatcaaaaaattcatgacattttgcgcaatgca
ccgacaggatatcaacctgtcacagaattagcagacttaatttacactcaacaaaataat
cacatacatctatgggggtaa

DBGET integrated database retrieval system