KEGG   Pasteurella multocida 36950: Pmu_01510Help
Entry
Pmu_01510         CDS       T01729                                 

Definition
(GenBank) glycosyl transferase, family 1 protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_trans_4_4 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AET15111
Position
complement(156239..157459)
Genome map
AA seq 406 aa AA seqDB search
MKILLLTQWFEPEPAIKGLAFAKELKAQGHDVQVLTGFPNYPGGKIYEGYKLRFFQKECI
EGIPVLRVALYPSHDSSAIKRILNYVSFAFMAMLFGIFATKKCDVIYAYHPPLTTGIAAI
MIKLFRRTPVIYDIQDLWPDTLKATGMLTHDRLLKIVDYVCQCVYKCVDHIVVLSPGFKE
KLIQKSVPANKISVIYNWCNETALINTETSQTVHLCHQKFNVLFAGNMGKAQALDTILDV
AANMHPYPDIHFTFIGSGTETTRLNTRKDDENLTNVTFIPRVPMSQIGHVLQQADLLLVH
LKQDALFEITVPSKIQAYMAIGKPILVAVPGDASNLVRLAQCGETALSENIESIQRAILK
MYHLPAQTRHLLGKNGNTFYFNELSLQKGTEKFIELFKKIKPEKSV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttactattaactcaatggtttgagcccgagccagctattaaagggttggca
tttgcaaaagaattaaaagcgcagggacatgacgtacaagtcttaactggctttccgaat
tatcccggcggaaaaatatatgaaggttataaacttcgatttttccaaaaagaatgcatt
gaaggcattcctgtattaagggtggcgctctacccaagccatgatagctcagccataaaa
cgcattctcaattatgtcagctttgcctttatggcaatgttattcggtatctttgcgacc
aaaaaatgtgatgttatttatgcctatcaccctcctttaacaacaggcatcgccgccatc
atgattaaactttttagacggacgcccgttatctatgatattcaagatttatggccagat
actttaaaagccactggcatgctaacgcatgatcgattactaaaaatcgtcgattacgtc
tgccaatgtgtttataaatgtgttgatcatattgtggttttaagccccggctttaaagaa
aaactcatccaaaaatccgttcccgcaaataaaatcagcgtgatctataactggtgtaac
gaaactgcgctaatcaacactgaaacgtcacaaactgttcatttatgtcaccaaaaattc
aatgttctttttgctggcaatatgggaaaagcgcaagccctcgatacgatactggatgtc
gcagctaatatgcatccttatcctgatattcattttacctttatcggttctggtacagaa
acaacacgcttaaacacgagaaaagatgatgaaaatttaacgaatgtgacttttatacca
cgtgtaccgatgtctcaaatcggtcatgtattacaacaagcagatttattactagttcat
ctgaaacaagacgcgttatttgaaatcacggttccctcaaaaatacaggcgtatatggca
ataggaaaacccattttagttgcggtaccaggagatgcgagcaatttagtgaggctcgca
caatgtggagaaaccgcgctatcagaaaatatcgagagcatacaacgtgccattttgaaa
atgtatcacttgccggcacaaacacgccatcttttaggcaaaaatgggaatactttctat
tttaatgaattatctttgcaaaagggtactgagaaatttattgaattgtttaaaaaaata
aaacctgaaaaatcagtttga

DBGET integrated database retrieval system