KEGG   Pasteurella multocida 36950: Pmu_01600Help
Entry
Pmu_01600         CDS       T01729                                 

Gene name
ubiF
Definition
(GenBank) 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase
  KO
K03184  3-demethoxyubiquinol 3-hydroxylase [EC:1.14.99.60]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00130  Ubiquinone and other terpenoid-quinone biosynthesis
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
Module
pmp_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Pmu_01600 (ubiF)
Enzymes [BR:pmp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.60  3-demethoxyubiquinol 3-hydroxylase
     Pmu_01600 (ubiF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 SE Trp_halogenase Pyr_redox_2 NAD_binding_8 DAO Pyr_redox_3 FAD_binding_2 GIDA FAD_oxidored Pyr_redox HI0933_like Lycopene_cycl Thi4 NAD_binding_7 ApbA
Motif
Other DBs
NCBI-ProteinID: AET15118
Position
complement(166437..167612)
Genome map
AA seq 391 aa AA seqDB search
MDVIQKDMIVVGGGMVGAACALGLGKQGHQVQLIEHAPLPQFQPNSPYDLRISAISVASV
NLLKQLGAWQYIENTRICPYRALETWEIEGFGTTFHSQELNLSELGFMIENNVVQLGLWQ
AISSIENIQTCVGCTIQKVEKCGENWQILLANGTTYQAPLIIAADGANSQLRQIANIGTS
GWQYRQSCLLITVDTELEQQDVTWQQFFPSGPRAFLPLLGKQACLVWYDSPQRIQTLKQL
SREKLAAQIEQAFPARLGKIKVQAANSFELTRTHAQDYFKQGIVLVGDAAHTINPLAGQG
VNLGFKDVNILLEVLQQASQKKEPLASDDVLIRYQRKRKPDNLLMQTGMDVFYKTFKEDI
LLLKIVRNASLFLANKATLLKKQALKYALGL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcatacaaaaagacatgatcgtggttggcggtggcatggttggtgcagcctgt
gcgcttggcttaggtaaacaaggacatcaagtccagcttatcgaacacgccccactccca
cagtttcaacctaattcgccttacgatcttcgcatttctgcgatcagtgttgcttccgtt
aatctcttaaaacaactaggtgcttggcagtatatcgaaaatactcgtatttgcccgtat
cgcgccttagaaacctgggagatcgaaggatttggtaccactttccatagccaagaatta
aacttatctgagctgggttttatgatagaaaataatgttgtacaacttggtttgtggcag
gcaatttcaagcattgaaaacatccaaacttgtgtaggatgtactatccaaaaagtcgaa
aagtgcggtgaaaattggcaaattttgctagctaatggtacaacttaccaagcccctctt
atcattgctgcagatggggcgaattcacagttacgccaaattgctaatattgggacgagt
ggttggcaatatcgtcaaagctgtttgcttattaccgtagatactgaacttgaacaacaa
gatgtcacctggcaacaatttttcccttctggaccaagagcctttctaccattattaggt
aaacaagcctgcttagtttggtatgattccccacaacgtatccaaaccctcaaacaactt
tctcgcgaaaaattagcggcgcaaattgagcaagcgttcccggcacgattaggaaaaatc
aaagtgcaagcagcaaatagctttgagctgactcgaacccatgcgcaagattactttaaa
caaggtattgtgctagtaggtgatgctgcacataccattaatcctcttgctggacaaggt
gtgaatctaggttttaaagatgtcaacattctgcttgaagtactacagcaggcgagtcag
aaaaaagagcctctcgccagtgatgatgtacttatacgctatcagcgtaaacgtaaacct
gataacctattaatgcaaacaggtatggatgtattttataaaacgtttaaagaagatatc
ttactgctcaaaatagtacgtaatgcctcattattcctcgccaacaaagcaacactattg
aaaaagcaggcattgaaatatgcattgggtttataa

DBGET integrated database retrieval system