KEGG   Pasteurella multocida 36950: Pmu_01650Help
Entry
Pmu_01650         CDS       T01729                                 

Gene name
macA
Definition
(GenBank) macrolide-specific efflux protein MacA
  KO
K13888  membrane fusion protein, macrolide-specific efflux system
Organism
pmp  Pasteurella multocida 36950
Brite
Transporters [BR:pmp02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   Pmu_01650 (macA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl Peptidase_M23 HlyD PTS_EIIA_1 DUF2118 OEP RnfC_N PASTA
Motif
Other DBs
NCBI-ProteinID: AET15123
Position
175717..176844
Genome map
AA seq 375 aa AA seqDB search
MRKYSKYALLILLLCLVTFYYISEEENSSDIIFPAIRSDIQKVITASGILQAKEEVEIGS
QASGQVKQIVVQEGQRVKKGDLLALIDPRIAETELKLAKAELESAEANLEVKRANLVLSD
VNLARHYQLNKKEATTKKDIEEAENKRIIASAELRMAQSQVESAKVKVEKASTELGYTEI
RSPLDGVVISVVAQSGQTLAASQQTPVLMKLAVIDTMKVNARVSEADVIDLQMGAPVHFT
LLGAPHAQFHAKLAAIKLSPVKVSEATYYYATFEVPNPDHKLRIAMTAEVSILLDKRENV
VTLPISALGQMLKPNHYSVTVLNQSGEKEQVIVKTGLKDGARIEIVEGLSEGDNVVLSVN
PATSLNDEEIYDLGL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaatacagtaaatatgccttgcttattttattactctgtctcgttactttttac
tatataagcgaagaggaaaatagcagcgatattatttttccagcgataagaagtgatata
caaaaagtgattacggcaagtggtattttgcaagcaaaagaagaagttgagattggttca
caggcctctggtcaagtgaaacaaatcgtggtgcaagaagggcagcgtgtcaagaaaggg
gacttattagctcttattgatccgcgtattgcggaaaccgagttgaagcttgcaaaagca
gagttagaaagtgctgaagcaaatttagaggtaaagcgagcgaatttggtgttatctgac
gtgaatttggcacgtcattatcagttgaataaaaaagaggctacgacaaaaaaagatatt
gaggaagccgaaaataagcgaattattgcaagtgcagaattacgtatggcgcaaagccaa
gtagaaagtgccaaagtcaaagtggaaaaagcgagcacagaattaggttatactgaaatc
cgttctccgcttgatggtgtagtgatttccgttgtggcacagagtggacaaaccttagcc
gcgagtcaacaaacaccggtgttaatgaaattggctgtcattgacaccatgaaagtgaat
gctcgggtttctgaagcggatgtgattgatctacaaatgggtgcaccagttcattttact
ttattaggggcaccacatgcacaatttcatgccaaattagctgcaattaaattatcacct
gtgaaagtgagtgaggcgacgtattattatgcaacttttgaggttcctaatcccgaccat
aaactacgtatcgcgatgacagcagaagtgtctattttattagataaacgagaaaatgtt
gtgacgctcccgatttctgcattaggacaaatgctcaaacccaatcactattctgtgact
gttttaaatcaatcaggtgaaaaagagcaggttatcgtgaaaacaggcttaaaagatggg
gcaagaatagaaattgtagaaggtttatctgaaggtgataacgttgtcctgtcagtaaat
ccagctacctccttgaatgacgaagaaatatatgatcttggattatga

DBGET integrated database retrieval system