KEGG   Pasteurella multocida 36950: Pmu_01710Help
Entry
Pmu_01710         CDS       T01729                                 

Gene name
metB
Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00270  Cysteine and methionine metabolism
pmp00450  Selenocompound metabolism
pmp00920  Sulfur metabolism
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
pmp01130  Biosynthesis of antibiotics
pmp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pmu_01710 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Pmu_01710 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Pmu_01710 (metB)
Enzymes [BR:pmp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     Pmu_01710 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_1_2 SelA Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AET15126
Position
179687..180796
Genome map
AA seq 369 aa AA seqDB search
MTQHYLIETLLAQAGNRTDERTGAVSTPIFLSTAYAHHGIGESTGYDYTRTKNPTRSVLE
ETIAKLEGGERGFACASGMAAIQLIMSLFTSPDEWIVSRDVYGGTYRLLDFAYKNTQGVK
PVYVNTSEVSCIEAAITSNTKAIFVETPSNPLMEECDVAAIAKIAKKHNLLLIVDNTFLT
PVLFRPIEAGADVVIHSGTKYLAGHNDALVGLVVAKGEELCQRLFYIQNGAGAVLSPFDS
WLTIRGMKTLALRMERHEQNAKQLAAFLASQLQVKNVLYPNKGGMLSFRLHEAHWVNPFL
KALKLITFAESLGGTESFITYPATQTHMDIPEEERIARGVCNCLLRFSVGLENVEDIKAD
LLQAFAQLN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacattatttaattgaaacgttattagcgcaggctggaaatcgaacggatgag
cgcactggtgcagtttctacaccgatctttttatcaacagcttatgcccaccatggaatt
ggtgaaagtacaggctatgactatacacgtacgaaaaatccaacacgtagcgttttagaa
gaaactattgccaaattagaaggtggggaacgaggctttgcttgtgcttcaggaatggcg
gcaattcaattaatcatgtccttatttacgtcccctgatgagtggattgtttcgcgtgat
gtgtatggtggcacctatcgtttattggatttcgcgtacaaaaatacacaaggcgttaaa
ccagtttatgtgaatacatcagaggtatcctgtatcgaagcggcgattacgtctaataca
aaagcaatttttgtagaaactccttctaatcctttgatggaggaatgtgatgtagctgcg
attgcaaaaattgcgaaaaaacataatctgcttttgattgtcgataatactttcttaaca
ccggttttatttagaccaattgaggctggtgcagatgttgtgattcatagtggaactaaa
tacttggctggtcataacgatgctttggttggactggttgtggcaaaaggtgaagaactc
tgccaacgtttattctatattcagaatggggcaggtgcagttctgtcgcctttcgattca
tggttaacgattcgaggcatgaaaaccctcgccttacgtatggaacgtcatgaacaaaat
gccaaacagttggctgcgtttctggcttctcagctacaagtaaaaaatgtgttatatcca
aataaaggcggtatgctttctttccgcttacatgaagcacattgggttaatccttttttg
aaagcgctgaaactaatcacttttgctgaaagtttggggggaacagagagctttattact
tatccagcgacacaaacccatatggatattccagaagaggagcgtattgcgcgcggtgtg
tgtaattgtcttttgcgtttttctgttggtttagaaaatgtagaggatattaaagcggat
ttattacaagcgtttgcacaattaaactaa

DBGET integrated database retrieval system