KEGG   Pasteurella multocida 36950: Pmu_01750Help
Entry
Pmu_01750         CDS       T01729                                 

Gene name
rluC
Definition
(GenBank) ribosomal large subunit pseudouridine synthase C
  KO
K06179  23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
pmp  Pasteurella multocida 36950
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pmp03009]
    Pmu_01750 (rluC)
Enzymes [BR:pmp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     Pmu_01750 (rluC)
Ribosome biogenesis [BR:pmp03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Pmu_01750 (rluC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AET15128
Position
complement(182068..183048)
Genome map
AA seq 326 aa AA seqDB search
MNQKKDEKVINQAVKMLTISEDEAGQRIDNYLLAKLKGVPKSLIYRILRKGEVRVNKGRI
KPEYKLQANDIVRVPPVRVSEKEQAPISTKLNKVSQLEKQILFEDECLLVLNKPSGIAVH
GGSGLSFGVIEALRTLRPDARFLELVHRLDRDTSGILLVAKKRSALRSLHEQLREKTVQK
DYLALVRGQWQSHCKVVKAPLLKNELSSGERIVRVSEQGKPSETRFSIEERYEYATLVKA
SPVTGRTHQIRVHTQYAGHPIALDDKYGDKHFDEQMTQLGLTRLFLHAFSIRFEHPKTGE
TLRINAPLDPEMKKILGALREQKSSN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaaaaaaagacgaaaaagtcatcaatcaagcagtaaaaatgctgacgattagt
gaagatgaagcagggcaacgtattgataattatttattagctaaactcaaaggtgtgcca
aaaagtttaatttatcgtattttgcgtaaaggcgaagtccgtgtaaataaagggcgtatt
aaaccagaatacaaactgcaagccaatgatattgtacgagttcctcctgtccgtgtgtca
gaaaaagaacaagcgcctatttcaactaaattaaataaagtcagccaattagaaaagcaa
attttatttgaagatgagtgtttattagtcttaaataagccctctggtattgctgttcac
ggtgggagtggattaagttttggcgtgattgaagccttacgcaccttacgtcctgacgcc
cgttttcttgagcttgtccatcgtttagaccgtgatacttcgggaattttattggtcgcg
aaaaaacgttccgccttacgcagtttacatgaacaattacgtgaaaaaacggtacaaaaa
gattatttagccttagtccgtgggcaatggcaatcccattgcaaagtggtgaaagcacca
ctactaaaaaatgagttatccagtggcgaacgtattgtacgagtcagtgaacaaggtaaa
ccgtctgaaacccgtttttcaatcgaagaacgttatgaatatgccactttggtaaaagcc
tcccccgtcacaggacgaacccatcaaattcgagtacacactcaatatgcaggtcatcct
atcgctttagacgataagtatggcgataaacactttgatgagcaaatgactcaattaggc
ttaacacgcttatttttacacgcgttttctattcgttttgaacaccctaaaacaggtgaa
acattacgcattaatgcaccattagatccggaaatgaaaaagatcttgggcgcattgcgt
gagcaaaaatcaagcaattaa

DBGET integrated database retrieval system