KEGG   Pasteurella multocida 36950: Pmu_01810Help
Entry
Pmu_01810         CDS       T01729                                 

Gene name
gloA
Definition
(GenBank) lactoylglutathione lyase
  KO
K01759  lactoylglutathione lyase [EC:4.4.1.5]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00620  Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pmu_01810 (gloA)
Enzymes [BR:pmp01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     Pmu_01810 (gloA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_2 CppA_N
Motif
Other DBs
NCBI-ProteinID: AET15133
Position
complement(189828..190235)
Genome map
AA seq 135 aa AA seqDB search
MRILHTMLRVTNLERSIQFYQQVLGMRLLRTSDNPEYKYTLAFLGYDDEENASVLELTYN
WGVTEYELGTAYGHIAIGVEDIYATCDAVRQAGGKITREPGPVKGGKTVIAFVEDPDGYK
IEFIENKHAQSGLGN
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattttacatacaatgttgcgcgtaacaaatttagagcgctcaatccagttttac
caacaggttttaggtatgcgtttactgcgtacaagtgacaatccggagtataaatatacg
ttggcatttcttggttatgacgatgaagagaatgcctccgtattagaattaacctataac
tggggcgtgactgaatacgaactgggtacggcttatggtcatattgcgattggcgttgag
gatatttatgcaacctgtgatgcggtacgacaagcaggcggtaaaatcacccgtgagccc
ggtccagtgaaaggtggaaaaacagtgattgcgtttgtcgaagatcctgatggttacaaa
atcgaatttattgaaaataaacatgcgcaatctggcttaggtaattaa

DBGET integrated database retrieval system