KEGG   Pasteurella multocida 36950: Pmu_01820Help
Entry
Pmu_01820         CDS       T01729                                 

Definition
(GenBank) membrane protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4401 GDYXXLXY DUF2157
Motif
Other DBs
NCBI-ProteinID: AET15134
Position
190349..192823
Genome map
AA seq 824 aa AA seqDB search
MQNTTLFHLSWRKYLTLLFLLLGTGFFASGVITWIAANWDYFSRFEKLYGVQSLFGVSIL
LSVFFYYYEAKKKQVTSVLPLVFAFLAAVLLGAIFALIGQTYQTGADPWELFAIWSICQI
PFLLLFPNVASALLLLVTANVALSLAISLLGDIVHMMIFLNMLFLVCYEYFGERLRDQNW
RVLPKIALLILVFAFGWALIVNNSVLLSWLLSAGLVYYYKERRFDFLNLIVLFFYLVVSI
CTKVLLSSGEDFLSDIFLVTILAFGGTIGAIITLIKWFKWHNPTASRVTWHIYPLFILLI
IFCTGLLLITLFFSFGLEDEQDLIYPSILFLIIALVMHFNQKEKADWFDIAIDMFMATGF
ILYFIFFLFDGENDLYLALMAILSVFLYQLRSSNWLRFLIASLFIIAFLVYIGFFDLRWY
AYYEEHLGQFVLSAQQWIILGGLLLYYFFSLSEERPYTIKLLPIAWAMLLVGLAMNLDIF
NRWTFLDTAQQTPEMSDLNDWFHVITGYFFTEVTPDNWLIKSLHLLISITPMIFFVLISR
RFELTKFLYASVLLTLLALCLGFIAVNETLACISLLLLAYLSVSRVLFALALLGVIMNLS
YYYYLLSIPLLHKSFLLMGVGIVLALVTFVLSRYNKAPQATLQAESHNTFQPQTMLRKKL
GFTLLATCLIAFATNYTIHKYEDILTNGESIILKTAPVDPRSLMQGDYMTLNYEILADIS
EEWGKNLEEEKTQYFVYALLKRDSLGIATLCRLETKAPTTFDGCTPNIYLPVNVAMWWPR
LPSQDYFFAEGKGEYYAQAEYAEYRFKGGKALLFRLLDKNLKAL
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatacgacgttgtttcatttatcttggcggaaatatcttactctcttatttctc
ctgctaggaaccggcttttttgcaagtggcgtgattacttggattgcggcaaattgggac
tatttttctcgctttgaaaagctttatggagtacaaagcctctttggcgtttctatcctt
ttaagtgtctttttttattactatgaagcgaaaaaaaagcaggttacttctgtacttcct
cttgtttttgcttttctcgctgcggtattgcttggggcaatattcgctttaattgggcaa
acgtatcaaacgggcgctgacccttgggaacttttcgctatttggtctatttgccaaatt
ccgtttttgctgttatttcctaatgtagcaagtgccttattattattggtcacggcaaat
gtggctttatctttagctatttccctgctcggtgatatcgtgcacatgatgatcttttta
aatatgctgtttctcgtgtgctatgaatattttggtgagcgtttaagagatcagaattgg
cgcgttttacctaagatcgcgttgcttatcttagtgtttgcctttggttgggcgctgatc
gtcaacaatagcgtgctgttgtcgtggttattgagtgcagggcttgtctattattataaa
gagcgtcgttttgactttcttaatttaatcgttttatttttctatttagtcgtcagtatt
tgtacgaaagtactattaagctcaggggaagattttttatcagatatctttttggtaacg
atattggcatttggtggcacgattggtgcgattatcacgttaattaagtggtttaagtgg
cataatcctactgcctctcgagtcacttggcatatttatccactctttattttattaatt
atattttgtactgggctactccttattactttatttttctcatttggtttggaagatgaa
caagatcttatctatccgagtatcctttttcttatcattgccttagtaatgcattttaat
caaaaagaaaaggcagactggtttgatattgccattgatatgttcatggcaacaggtttt
attctgtatttcatttttttcctttttgatggagaaaatgacctttatcttgcgttaatg
gcaatactatcggtctttttgtatcaattacgttcatcaaattggctacgtttcttaatt
gcatcactctttatcatcgcgtttttagtttacattggtttttttgatttgagatggtat
gcctattatgaagagcatttagggcaatttgtgttatctgcacaacagtggataattctt
ggtggtttgctactttattactttttttcgttaagtgaggaaagaccgtatacgataaag
ctattacctattgcttgggcaatgttattagtcggtttggctatgaatcttgacatattc
aaccgttggacatttcttgacactgcacaacagacaccagaaatgtctgatttaaatgac
tggtttcatgtcattactgggtatttttttacggaggtaacccctgataattggttgata
aagagtctacatttattgatatccatcaccccgatgatattttttgtgttaataagtcga
cgttttgagttaactaagtttctgtatgctagcgtactattgactcttcttgcactgtgt
ttgggttttattgcggtgaatgaaaccctagcgtgtatttctttgttattgttggcttat
ttaagcgttagccgagtattatttgcgctcgcgttgttgggcgtgatcatgaatttgagc
tattactattatctcttgagtatccctttattacataaatctttcttactcatgggagta
ggcatcgttctggcactagttacgtttgttttatcacgttataacaaggcaccgcaggca
acattacaagctgaatcgcacaatacgtttcaaccacaaacaatgttacgtaaaaaacta
ggattcactttgttggcgacatgtttgattgcctttgccacgaattatactattcataaa
tatgaagatattttaacgaatggtgagtcaattattttaaaaacggcacccgttgatccg
cgttccttgatgcaaggggattatatgacgttgaactatgaaatcttggcagacattagt
gaggaatggggaaaaaatttagaagaggaaaaaacacagtattttgtttatgcgttgtta
aaacgagacagcctagggattgctaccttgtgtcgtcttgaaaccaaagcacctacaaca
tttgacgggtgtacaccaaatatttacttaccggtgaatgtcgcgatgtggtggccgcgt
ttaccaagtcaagactacttttttgccgagggaaaaggtgaatattatgcacaagctgaa
tatgccgaatatcgctttaaagggggaaaagcgttgttgttccgcttactagataaaaat
ttaaaagcattataa

DBGET integrated database retrieval system