KEGG   Pasteurella multocida 36950: Pmu_01840Help
Entry
Pmu_01840         CDS       T01729                                 

Definition
(GenBank) isoprenylcysteine carboxyl methyltransferase family protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICMT PEMT DUF1295 DUF4383 DUF3262 Steroid_dh Wzz
Motif
Other DBs
NCBI-ProteinID: AET15136
Position
complement(193656..194174)
Genome map
AA seq 172 aa AA seqDB search
MLFINITFACILAIRFYSLSISIRHEKALIAKGAIQYGKRNSTLLSIAHVVFYLAAIIEA
NNQNTAFNSTSQIGLAILVFAIAMLFYVIYELKEIWTVKLYILPEHHINRSFLFKYVRHP
NYFLNIIPELIGLSLFCQAKYTALIGLPIYLLILGVRIKQEESAMAHLFPKS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgttatttatcaatatcacttttgcctgtattttagcgatccgtttttatagtctgtct
atttcaatccgccatgaaaaagcattgattgcaaaaggtgcaatacaatatggtaaacgc
aattctacgctgttatccattgcccatgttgtattttatctcgccgcgatcattgaagct
aataaccaaaacacagcatttaatagcacctcacaaatagggctggcgattttagtcttt
gcgatcgccatgctattttacgtgatttatgaactgaaagagatttggacagtaaaactt
tacattttaccggaacatcacattaaccgctctttcttgtttaaatacgtacgtcacccg
aattatttcttaaacattattcccgagttaattggtttatcgcttttctgccaagcaaaa
tataccgcattgattggattacccatttatttgcttatcctaggcgtgcgtattaaacaa
gaagaaagtgccatggcgcatttattcccgaaatcataa

DBGET integrated database retrieval system