KEGG   Pasteurella multocida 36950: Pmu_01940Help
Entry
Pmu_01940         CDS       T01729                                 

Definition
(GenBank) putative cytochrome oxidase subunit 1
  KO
K00425  cytochrome bd ubiquinol oxidase subunit I [EC:1.10.3.14]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00190  Oxidative phosphorylation
pmp01100  Metabolic pathways
pmp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Pmu_01940
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pmu_01940
Enzymes [BR:pmp01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Pmu_01940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_I
Motif
Other DBs
NCBI-ProteinID: AET15146
Position
201956..203518
Genome map
AA seq 520 aa AA seqDB search
MLDVVELSRLQFALTALYHFLFVPLTLGLSFILVIMETLYVATGKEVYKDMTKFWGKLFG
INFALGVTTGITMEFQFGTNWSYYSHYVGDIFGAPLAIEALLAFFLESTFVGLFFFGWDR
LSKGKHLIATYCVAFGSNLSAMWILVANGWMQYPVASEFNFETMRMEMTSFMDLWLNPVA
QSKFLHTLSAGYVSGAMFVLGISAYYILKGRDLGFAKRSFSIASTFGVISIFSVIIMGDE
SGYEIGQTQPVKLAAMEGEWHTQPAPADWNLLVVPNKAEKRNDFAIQIPYAAGIIVTRSL
DKQFAGLADLEALNVERVRNGVQAYDLLLQLQAQKKAGQISEETKAQFNAVSKDLGFGLL
LKRYTDKVVDATEEQIKQAAADTIPNVGPTFWSFRIMMAAGGLLLLLLVGAFVQNVRKTV
GTKPWFLKALLWSIPLPWIAIESGWFLAEYGRQPWAIYEVLPVGVANSALTTGDLWFSIG
LICALYTLFLVVEMYLMFKYGRLGPSSLKTGRYYFEQSSK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgttgttgaactctctcgattgcagtttgcattaactgcgttatatcacttt
ttgtttgtgccattaacactaggtttatcgttcattctagtgattatggaaacgctctat
gtagccacaggcaaagaagtttataaagatatgacaaaattctggggtaagttatttggt
attaactttgctctcggtgtcacaactggtattacaatggaattccagtttggtacgaac
tggtcatattattctcattatgtgggagatatttttggtgcgcctcttgcaattgaagca
ttattggcattcttcttagagtcgactttcgttggtttattcttctttggttgggacaga
ttatcaaaaggtaaacacttaattgcgacatactgtgtggcatttggttcaaatttatcc
gcaatgtggattcttgttgcaaacggttggatgcaataccctgtcgcttctgagtttaat
tttgaaaccatgcgaatggaaatgaccagctttatggatttatggttaaacccagttgca
caaagtaaattcttacatactctctctgcaggttatgtgagtggtgcaatgtttgtatta
gggattagcgcttattatatcttgaaaggtcgtgatctcggttttgctaaacgttcgttt
tctattgcttccactttcggtgtgatttctattttctcggtgatcatcatgggtgatgaa
tctggttatgaaatcggtcaaacacagcctgtgaaattagcagcaatggaaggggaatgg
catactcaacctgcaccagctgactggaatttacttgtagtgccaaataaagcagagaaa
cgtaatgattttgctattcaaattccttacgctgctgggattattgtgacacgttcttta
gataaacaatttgcgggtcttgctgatttagaagcgttgaatgtggaacgtgtacgtaat
ggtgttcaagcatatgacttgttacttcaattacaagcacagaaaaaagcaggtcaaatc
agtgaagaaacaaaagcacaatttaatgctgtctctaaagatctcggttttggtttatta
ttgaaacgttataccgacaaagtggttgatgcgactgaagagcaaattaaacaagctgcg
gcagatacaattccaaatgtgggacctactttctggtctttccgtatcatgatggcagca
ggtggtttattacttcttcttctggttggtgcatttgtacaaaatgtgcgtaaaacagtg
ggaacaaaaccttggttcttaaaagcgcttttatggtcgattccattaccatggattgca
attgaaagtggttggttcttagctgaatatggtcgtcaaccttgggcgatttatgaagtg
ttaccagttggtgtggctaactctgcactcacaacaggtgatctttggttctccattgga
ttaatctgtgcactttataccttattccttgtagtagaaatgtatttaatgttcaaatac
ggtagattaggaccaagttcattaaaaacaggtcgttactactttgaacagtcatctaaa
taa

DBGET integrated database retrieval system