KEGG   Pasteurella multocida 36950: Pmu_01970Help
Entry
Pmu_01970         CDS       T01729                                 

Definition
(GenBank) thioesterase superfamily protein
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
pmp  Pasteurella multocida 36950
Brite
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pmu_01970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2 Acyl-ACP_TE
Motif
Other DBs
NCBI-ProteinID: AET15149
Position
205202..205612
Genome map
AA seq 136 aa AA seqDB search
MVANVFNFPIRVYYEDTDAGGVVYHARYLHFFERARTEYLRCAGFSQHTLLNEQQLAFVV
KTMNIDYRYPAKLDNLLIVETLVTELKGASIFFTQRLKKEEQILCEATVKVACVDLGKMK
PIAIPAEMKAVLVNEL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccaatgtatttaattttcctattcgtgtttattatgaggatactgacgcgggt
ggtgtcgtttatcatgcgcgctatttgcatttttttgagcgagcaagaacagaatatttg
cgttgcgcgggattttcacagcatacactgttaaatgaacaacagctcgcttttgttgtc
aaaacaatgaatattgattatcgctatccagcaaagctcgataatttattaatcgtcgag
acgttagtcactgagttgaaaggcgcatcgattttcttcactcaacgattaaagaaagag
gaacagattttatgcgaggctacagtaaaagtagcctgtgttgatcttggaaaaatgaaa
ccaatcgctattcctgcagagatgaaagctgtattggtaaatgagttataa

DBGET integrated database retrieval system