KEGG   Pasteurella multocida 36950: Pmu_02020Help
Entry
Pmu_02020         CDS       T01729                                 

Gene name
pal
Definition
(GenBank) outer membrane protein P6
  KO
K03640  peptidoglycan-associated lipoprotein
Organism
pmp  Pasteurella multocida 36950
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmp02000]
    Pmu_02020 (pal)
Transporters [BR:pmp02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Pmu_02020 (pal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmpA DUF4223
Motif
Other DBs
NCBI-ProteinID: AET15154
Position
209396..209848
Genome map
AA seq 150 aa AA seqDB search
MKKLTKVLLVAGSVAVLAACGSSKKDESAGQMFGGYSVQDLQQRYNTVYFGFDKYNIEGE
YVQILDAHAAFLNATPATTVVVEGNTDERGTPEYNIALGQRRADAVKHYLSAKGVQAGQV
STVSYGEEKPAVLGHDEAAYSKNRRAVLAY
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactaactaaagtattattagttgctggttctgttgctgtattagctgcttgt
ggttcatctaaaaaagatgaaagcgctggtcaaatgtttggcggttattcagtacaagat
ttacaacaacgttataataccgtgtatttcggcttcgataaatacaatatcgaaggtgaa
tatgtacaaattttagatgcacatgcggcgttcttaaatgcaacaccagcaacgacagtc
gttgttgaaggtaacaccgatgagcgcggtacaccagaatataacatcgcattaggtcaa
cgtcgtgcagatgcagtaaaacattatttatcagcgaaaggtgtacaagctggtcaagta
tcaacagtttcttacggtgaagagaaacctgctgtgttaggtcacgatgaagcagcttac
tctaaaaaccgtcgtgctgtgttagcatactaa

DBGET integrated database retrieval system