KEGG   Pasteurella multocida 36950: Pmu_02060Help
Entry
Pmu_02060         CDS       T01729                                 

Definition
(GenBank) membrane protein
  KO
K02680  prepilin peptidase dependent protein B
Organism
pmp  Pasteurella multocida 36950
Brite
Secretion system [BR:pmp02044]
 Type II secretion system
  Type IVa pilus homolog protein
   Pmu_02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N_methyl
Motif
Other DBs
NCBI-ProteinID: AET15156
Position
210940..211653
Genome map
AA seq 237 aa AA seqDB search
MLFRGYTVLSLMISLSLSSLLLLVAIAFYVDVQRQNRAIHFQMQLQAELERVIQLMGKDI
RRAGFRAPPETTNKVNFSLFESETQASLQLFSIHGGNVSDCILFFYDLDMNGCLGGKFKE
KTCIKDGRNNTSHLERELFGYRLNNGMLETRLTYKSAVNSRCKLAECRTYLQQSACHSGG
WVDLLDDQEYIISDLSFHWLMGKPALEIYLKGYLKKQPHFQYETTMVVPLLNHGEKQ
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgttatttcgcggttatacagtattgagtttgatgatctcgttaagtctttcttctctt
ttgttacttgttgctatcgctttttatgttgatgttcagagacaaaatagggcaatccat
ttccaaatgcaactgcaagctgagctagaaagagtgattcaattaatgggaaaagatatt
cgtcgagcgggctttcgtgcgcctccagagacgacgaataaagtgaacttttcactgttt
gaatcagaaacacaggctagtttacaactgttctcaatacatggcggaaatgtatcggat
tgtattttatttttttatgatctggatatgaacggttgtttagggggaaagttcaaagag
aaaacctgtattaaggatggacgaaataataccagtcaccttgaacgtgagctgtttggt
taccgtttgaataatgggatgctcgaaacacgcttaacatataaaagtgcggtaaattct
cgctgtaaattagcagaatgtcgtacttacttacaacagtcagcgtgtcatagtggtggc
tgggtagatttattagatgatcaagaatatatcatcagcgatttatcatttcattggctc
atgggaaagcctgcgcttgaaatctatttgaaaggatacttaaaaaaacagccacatttt
caatatgaaacgacaatggttgtaccactcttgaatcatggagagaagcaatga

DBGET integrated database retrieval system