KEGG   Pasteurella multocida 36950: Pmu_02090Help
Entry
Pmu_02090         CDS       T01729                                 

Gene name
recC
Definition
(GenBank) exodeoxyribonuclease V gamma chain
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pmu_02090 (recC)
Enzymes [BR:pmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Pmu_02090 (recC)
DNA repair and recombination proteins [BR:pmp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pmu_02090 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma
Motif
Other DBs
NCBI-ProteinID: AET15159
Position
212643..216017
Genome map
AA seq 1124 aa AA seqDB search
MFTIYYSNDLDVQKNILLTLMQDTLDDPFQSDVILVQSPGMAQWLQWKIAEQQGISSNIK
FPMPASFIWQQYVDNLPNTEEQSQFNKASMTWRLMRLIPEHLEQVEFQSLRHYLSSSHQA
EQQKLYQLAYQIADLFDQYLVYRPEWIACWERGDEATMMAQLERKLKDTRLPIGNAFSQD
VKWQAILWRALVADILAESGQTVPLHRAYLQTQFLQFLQTQHPVNLPPRLFIFGISALPK
GYLEIFYAMSRYCEVHLFFTNGCREYWGDLIDPRFMQRLSQMQRTGYHTALPIPVFHHTD
NARFESSYDHEHLFEGHPLLSSWGKLGRDFLYLLTELEQLEGVRSIDAYTELTSQHLLSQ
VQARILHLEGKQGLNLAENDRSLTFHSCHSPMREVEVLHDYLLHLFQQDSTLTPKDIVVM
VADIDKYTPYIQAVFGQYNQVAQRQIPFSISDNRLSENDVLIASFIHLLALKESQFSAED
ILALLDIPAIRNRFQIELMELEQIRHWVAHAGIRFGVEKEQGKQEKNTNSWQAGLERMLL
GYAMREENGIWQGNLGFDPCYGLQGQLAGRLAEFIARLSAWYQFLQTPQPIEKWQQHLLT
LLTDFFAEDETNITTLLYIQETIVQMVTDIQQTHFDQPLSSEVVSDVLSALLEDDPNSMK
FLAGKVNFCTLLPMRSIPFKVVCLLGMNEGDYPRQQTPNSFDLMQYDRRKADRFRRDDDC
YLFLEALLSAQEAFYVSFVGRSIVDNQSKPPSVLVSQLIDYLVDKLPSAGTQDWQARLIE
QHPMTAFSPDNFRGENGSFANQWLPLANIQKQERADFVQPIAQTVLAEDREIALADLIAF
IQHPVAFFFKRHLGVSFTKQEERIEDSENFTLDGLMRYQINEQLLYCDEEKSAEVLAQLK
VKGMLPRGEFAQIFALQQQEDIAALKTIVADYLKQEAHVVEVDLTIPSGYSDIRLIGQLD
QLYAQRRVMWRVGQIQEKHLIENWVYYLIQCAMLAQHEPPIYYGKNGQATFQALCASESL
SVKEIALAQLQIYVESYLQGYQQMQMVPMKNIQRYLEAYEHTETPDFEMIRTLLHHLAEG
DYASDGDIYWQRVLAQQVLDEEMLNAIGERTTSWFKLMFEQLEK
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
gtgtttacaatttattattctaatgatcttgatgtacaaaaaaatattttgctcacgtta
atgcaagatacactggatgatccctttcagtcagacgtgattttagttcaaagtccaggc
atggcacagtggttgcaatggaaaattgcggagcagcaagggatttcgagtaatattaag
tttcctatgcctgcgagctttatttggcaacaatacgtagacaatttaccgaatacagag
gaacaaagccaatttaataaagcgtcgatgacatggcgtttaatgcgtttaattcctgag
catcttgaacaagtcgaatttcaatcacttcgtcattatttatcttcttctcatcaagca
gaacaacaaaagttgtatcaattagcctaccaaattgctgatttatttgaccaatatctt
gtttaccgcccagaatggatcgcttgttgggagcgtggtgatgaagccactatgatggca
cagttagaacgcaagctaaaagatacacgcctaccaataggcaacgctttttctcaagat
gttaaatggcaagcaatactatggcgtgctctagtggcggatattttggctgaaagcggt
cagactgttcccttacatcgtgcttatttacaaacacaattcttgcagttcttacagacc
cagcatcctgtcaatttacctccacgtcttttcatttttggtatctcagcgttgccaaaa
ggctatttagagattttttatgccatgagccggtattgtgaagtacatttatttttcacc
aatggctgtcgtgaatattggggtgatttaattgatccgcgttttatgcaacgcttaagc
caaatgcaacgaactggctaccataccgctttacctatacctgtttttcaccatacagat
aatgcccgatttgaatcaagttatgatcatgagcatttatttgaggggcatcctttgctg
tcaagctgggggaaattgggacgagattttttatatttattaacagaattagaacagctc
gaaggcgtacgaagtattgatgcgtacaccgagttaacttcccaacatcttttatctcag
gtacaagcgcgtattttacatttagaaggcaagcaaggtttaaatttggctgaaaatgac
cgctctttaacgttccattcttgccatagccctatgcgtgaagttgaagttttacatgac
tatttgcttcatttatttcagcaagactcgacacttactccaaaagatattgtggtgatg
gtggcggatattgataaatatacaccctatattcaagctgtatttgggcagtacaatcag
gtcgcacagcggcagattcctttttctatttcggataaccgtctttctgaaaatgacgtg
ttaatagcaagttttattcacttacttgctttaaaagagagtcagtttagcgcagaagat
atcttagctttattagatattcctgcgattcggaataggtttcagattgagttaatggag
ttagagcagattcggcattgggtcgcacatgctggcatacgttttggtgtagaaaaagaa
caaggtaaacaagaaaagaacactaactcatggcaagctgggctggagcggatgctgctt
ggttatgcgatgcgtgaggaaaatgggatttggcaagggaatttaggctttgatccttgt
tatgggctacaagggcaattagccggacgcttggcggagtttattgcaagattatcagca
tggtatcagtttttacaaacgcctcagcctattgaaaaatggcaacagcatttacttacg
cttttaacagatttcttcgctgaggatgaaacgaatattaccactttgctatatattcaa
gaaacgatagtgcaaatggtaacagatattcaacaaacacattttgatcaaccgttaagt
agtgaagtggtttctgatgtcctgtcggcattattagaagatgatccgaatagcatgaag
tttctggcagggaaagtgaatttctgtaccttgctaccgatgcgttcgattccctttaaa
gtggtgtgtttactggggatgaatgaaggtgattatcctcgtcaacaaacgccaaatagc
tttgatttgatgcaatatgatcgacgtaaagccgaccgttttcgccgtgacgatgattgt
tatttgttccttgaagcgctgctgtcagcacaagaggcattttatgtgagttttgtggga
cgttccattgtggataaccaaagcaaacctccgtctgtgttagtcagtcaattgattgac
tatttagtagataagttaccaagcgctggaacacaagattggcaggctcgattaattgaa
cagcatccgatgacagcatttagtccagataatttccgaggagaaaacggatcttttgct
aaccaatggttacccctagcaaatattcagaaacaagagagggcggattttgtccaacct
atcgcacaaacagtgttagccgaggatcgtgaaattgcgttagcggatttaattgccttt
attcaacatcctgttgcgtttttctttaaacgtcatttaggcgtttcttttactaaacaa
gaagaacgtattgaagacagcgaaaattttactttagatggcttaatgcgctatcaaatt
aatgagcaattgctttattgtgatgaggaaaaaagcgcggaggttctcgctcaattaaaa
gtaaaaggtatgctaccgcgtggtgaatttgctcagatctttgcgttacaacaacaagaa
gacattgccgcgttaaaaacaatcgttgccgattatttaaaacaagaggcgcatgtcgtc
gaagtggatttgactatcccgagtggctatagcgatattcgtctgattgggcagctagat
cagttgtatgcacagcgtagagtgatgtggcgagtgggacaaattcaggaaaaacattta
attgaaaattgggtgtattaccttattcaatgtgcaatgttagcacagcatgaacctcct
atttattatggtaagaatgggcaagcgacctttcaagcgttgtgtgctagcgagtcgtta
agtgtaaaagaaatcgcgttagcacaattacaaatctatgttgaaagttatttgcagggc
tatcagcagatgcaaatggttccgatgaaaaatattcaacgttatttagaagcatatgaa
catactgagacgccagattttgagatgattcggacattgttacatcatctagcggaaggg
gattatgcttcggatggggatatttattggcaacgagtacttgcacaacaagtactcgat
gaggagatgctcaacgcgataggtgaacggacaacatcgtggtttaagcttatgtttgag
cagcttgaaaaatag

DBGET integrated database retrieval system