KEGG   Pasteurella multocida 36950: Pmu_02120Help
Entry
Pmu_02120         CDS       T01729                                 

Gene name
rsmC
Definition
(GenBank) ribosomal RNA small subunit methyltransferase C
  KO
K00564  16S rRNA (guanine1207-N2)-methyltransferase [EC:2.1.1.172]
Organism
pmp  Pasteurella multocida 36950
Brite
Enzymes [BR:pmp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.172  16S rRNA (guanine1207-N2)-methyltransferase
     Pmu_02120 (rsmC)
Ribosome biogenesis [BR:pmp03009]
 Prokaryotic Type
  rRNA modification factors
   16S rRNA modification factors
    Pmu_02120 (rsmC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS MTS_N Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_2 PrmA Methyltransf_23 Methyltransf_16 Methyltransf_11 Methyltransf_10 Methyltransf_18 TehB NodS Cons_hypoth95 UPF0020
Motif
Other DBs
NCBI-ProteinID: AET15162
Position
216984..217970
Genome map
AA seq 328 aa AA seqDB search
MISLESQVLQRHLSFFEHKSVLFAGGINDQFPQQVPARSVKVWSWYFDYAKSKSAVDFSL
TCEEKADLMVFYWTKNKQEVQFQLMQLLAQAPIGQEMLIVGENRCGVRSVEKMLDAYGDI
AKIDSARRCGLYHFCLKNTPHFALADYWKTYQHPRLGDLRIYSLPGVFSANELDVGTDLL
LSTLDQPVRGKVLDLGCGAGVIGAYIKQQYPQVELTMADIHALALASSQRTLVENQLEAE
VIASDVFSNVTGKFDLIISNPPFHDGIDTAYRAVSELIMQAKWHLVPGGELRIVANAFLP
YPDLLDQHFGSHCVLAKTTKFKVYSVRG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgatttctcttgaaagccaagttctacagcgtcatctttctttttttgagcataaatca
gttttatttgcggggggcattaatgatcagtttcctcagcaagtgccggcgcgcagcgtg
aaggtatggagttggtattttgattatgccaaaagcaaaagtgcggtcgatttttcatta
acttgtgaagaaaaagcggatctcatggtgttttactggactaaaaacaagcaagaagtg
caattccaacttatgcaattactcgctcaagcgccgattggtcaagaaatgttgattgta
ggtgaaaatcgctgcggagtgcgttctgtggaaaaaatgctcgatgcttatggcgatatt
gctaaaattgactcggcaaggcgttgtgggttatatcatttttgtttaaaaaacacaccg
cactttgcgttagcagattattggaaaacttatcagcatcctcgcttaggtgatttacgt
atttacagtttaccgggggtatttagtgcgaatgagttggatgttggcacagatttgttg
ctttcaaccttagatcaaccagtgagaggaaaggtgttagatttaggttgtggtgcgggt
gtgattggtgcttatattaaacagcaatatcctcaagttgagctgactatggcggatatt
catgcgctagccttagcttctagccaacggactttagttgagaaccagttagaagctgag
gtgatcgccagtgacgttttttctaatgtgacaggaaaattcgatctgattatttcaaat
cccccttttcacgatggcattgacacggcttatcgtgctgtcagtgaattaattatgcaa
gcgaaatggcatttagtaccgggcggcgaattacgcattgtggcgaatgcattcttgcct
tatcctgatttattggatcaacattttggctcacattgtgtgttagccaaaaccactaaa
tttaaagtgtattctgtccgcggctaa

DBGET integrated database retrieval system