KEGG   Pasteurella multocida 36950: Pmu_02260Help
Entry
Pmu_02260         CDS       T01729                                 

Gene name
ychM
Definition
(GenBank) sulfate transporter YchM
  KO
K03321  sulfate permease, SulP family
Organism
pmp  Pasteurella multocida 36950
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pmp02000]
    Pmu_02260 (ychM)
Transporters [BR:pmp02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Pmu_02260 (ychM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sulfate_transp STAS
Motif
Other DBs
NCBI-ProteinID: AET15170
Position
228639..230378
Genome map
AA seq 579 aa AA seqDB search
MLKKWFLSKNVFLAVKPFSALKESFRAGYTRQSLIRDIIAGLTIGVIAIPLSMALAIASG
VAPQHGLYTAIVAGMIIAVTGGSRFNVSGPTAAFVVILYPITQQFGLGGLLMATLLSGLI
LVLMALFRLGRLIEYIPLPVTLGFTCGIGIVIATLQIKDFLGLSILEMPAHYLEKVQTIV
TALPTINWADALVGIVTLLMLTQWHKLRLPIPGHLPAVIIATLLSLGLISVGQDVATIGS
AFQYTLSDGTQGFGIPNALPEFILPWHIPNAQGEVITWNLETIQALLPAAFSMAVLGAIE
SLLCAVILDNMTDTKHHSNNELLAQGLGNIAAPFLGGITATAAIARSVANVKAGGVSPIS
SVVHALLVLFALLFFANALSYLPLSSMAALLLVVAWNMANVPQIIQLIRRSGRNEIAVLL
TCLILTVIFDMVIAITVGVLLASLLFIRTIAEMTKSIEIAHPEDLNDVLVYRISGPLFFA
AADNLFADLHDKTVNTEHEIKHIVLQCDAVTVLDTGGIHALTRFVQHMLPHQQLYMCNMQ
FQPLRMIVKSNTVNEIQKINFASDLSDAFNKIRVFEQQA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaaatggtttctcagcaaaaatgtgttcttagccgttaagccttttagtgcg
ttaaaagagagttttcgcgcaggttacacgcgtcaatctttaattagagatattatcgcc
ggtttaactattggggtgattgcaattcctttgtcaatggcactggcgattgccagtggc
gtagcgcctcaacatggtttatatacagcgattgtcgcagggatgattatagcggtaaca
gggggatcgcgttttaatgtttctggtcccacggcggcatttgtagtgattttgtacccg
attacgcaacagtttggtttgggtggcttgttaatggccacgttgttatcgggcttgatt
ttagttctcatggctttgttccgcttaggacgtctcatcgaatacattcctttgcccgtt
accctaggttttacctgtggaattggtatcgtcattgccacgttacaaattaaagatttt
ttagggctatctattttggaaatgcctgcgcattatcttgaaaaagtgcaaactattgtc
actgcattaccgacgatcaattgggctgatgctcttgttgggatcgtgaccttattgatg
ttaacgcaatggcataaattacgtttacctattccgggtcatttacctgctgtgattatt
gccacgttattgtctttaggcttaatttctgtaggtcaagatgttgccaccattggttca
gcctttcaatacactttatccgatggcacacaaggatttggtattccaaatgccttacct
gaatttatcttgccttggcatattccgaatgcacaaggggaagtgattacttggaattta
gagaccattcaagcgttattaccggcagcgttttctatggcagtattaggcgcaattgaa
tccttattatgtgcggtgattttagataatatgacagacacaaaacaccattctaataat
gaattattagcacaaggattagggaatattgccgcaccgtttttaggggggatcacagcg
acagcggcgattgcgcgttctgtcgcgaatgtaaaagcaggtggcgtgtcacctatttcc
agtgttgtacatgcattattggttctgtttgcgctcttgttttttgcaaatgcgttatct
tatttaccgctttcgtcgatggcagctttattgctcgttgtggcatggaatatggcaaat
gtaccccaaattattcagctcatccgccgctctggtcgtaatgaaatcgcggtgttatta
acgtgcttaattttaacagtcatttttgatatggtgattgcgattactgttggcgtctta
ttagcaagtttactgtttattcgtacaattgcagaaatgacaaagtcgattgaaattgcc
catcctgaagatttaaatgatgtgctagtttatcgtattagtggaccgttattttttgct
gcagcagataatttatttgccgatttacatgataaaaccgtcaataccgagcatgaaatt
aaacatattgtattgcaatgcgatgcggtcacggtgctcgatacgggaggtattcatgcg
ttgactcgttttgtacaacatatgttgccacatcaacagctttatatgtgtaatatgcaa
tttcaaccgctacgaatgattgtcaaatcgaatacggtaaatgaaattcagaaaattaat
tttgcttcggatttgtcagatgcttttaataaaatccgcgtttttgaacaacaagcataa

DBGET integrated database retrieval system