KEGG   Pasteurella multocida 36950: Pmu_02300Help
Entry
Pmu_02300         CDS       T01729                                 

Gene name
ppiB1
Definition
(GenBank) peptidyl-prolyl cis-trans isomerase B
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
pmp  Pasteurella multocida 36950
Brite
Enzymes [BR:pmp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Pmu_02300 (ppiB1)
Chaperones and folding catalysts [BR:pmp03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Pmu_02300 (ppiB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-ProteinID: AET15174
Position
233356..233865
Genome map
AA seq 169 aa AA seqDB search
MITLHTNLGNIKIQLDHEKAPNTAQNFVNYCKSGFYDNTIFHRVIDGFMIQGGGMDEAMR
EKKTNAPIQNEANNGLSNKRGTIAMARTSDPHSATAQFFINVADNTFLDHRSKELFGKKV
VQEWGYAVFGEVVEGMDVVDKIKGVKTGNKGFHQDVPQEAIVITAVTVE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgattacattacacactaacttgggtaacattaaaattcaattagatcatgaaaaagca
ccgaacacagcacaaaactttgtaaattactgtaaaagtggattctatgataacacaatt
tttcatcgtgttattgatggatttatgatccaaggtggtggtatggatgaggcgatgcgt
gagaaaaagacgaatgcgccgatccaaaatgaagccaacaatggtttaagtaacaaacgt
ggcacaattgcgatggcgcgaacatcggatcctcattctgcgaccgcacaattttttatt
aatgtagcagataatacttttttagatcaccgttcaaaagagttatttggtaaaaaggtg
gtacaagagtggggctatgccgtctttggtgaagtggttgagggcatggatgtagtagat
aagatcaaaggcgtgaaaaccggaaataaagggtttcaccaagatgtaccacaagaagcc
atcgtgattactgcagtgaccgttgaataa

DBGET integrated database retrieval system