KEGG   Pasteurella multocida 36950: Pmu_02340Help
Entry
Pmu_02340         CDS       T01729                                 

Gene name
nrdG
Definition
(GenBank) anaerobic ribonucleoside-triphosphate reductase-activating protein
  KO
K04068  anaerobic ribonucleoside-triphosphate reductase activating protein [EC:1.97.1.4]
Organism
pmp  Pasteurella multocida 36950
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Pmu_02340 (nrdG)
Enzymes [BR:pmp01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.4  [formate-C-acetyltransferase]-activating enzyme
     Pmu_02340 (nrdG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_12 Fer4_14 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AET15178
Position
complement(235669..236157)
Genome map
AA seq 162 aa AA seqDB search
MKPAMNYVQYYPTDIVNGEGTRCTLFVSGCTHACRGCYNKKSWSFCAGLPFDEKMEAQIL
QDLKDTRIKRQGLTLTGGDPLHPRNLAVLLPFVKRVKHECPDKDLWVWTGYTLAELKADT
LQRQILPYIDVLIDGKFEQDKADPSLVWRGSANQIIYRFTQY
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgctatgaattacgtccaatattatcctactgacatcgtgaatggagaagga
acaaggtgtacactttttgtcagtggctgtacgcatgcttgccgaggttgctacaacaaa
aaaagttggtctttttgtgctggccttccattcgatgaaaaaatggaagcacaaatcctt
caagatctcaaagatacccgtattaaacgccaaggattaaccttaacaggtggtgatccg
ctccatccacgtaatctggcggtacttcttccctttgtcaaacgagtcaaacacgaatgt
cctgataaagatctttgggtctggacgggttataccttagcagagctcaaagccgataca
ttacaacggcaaatactgccttatattgatgtcttaattgatggtaagtttgaacaggat
aaagcggatccaagccttgtatggcgcggttctgctaatcagattatttatcgtttcaca
caatactaa

DBGET integrated database retrieval system