KEGG   Pasteurella multocida 36950: Pmu_02490Help
Entry
Pmu_02490         CDS       T01729                                 

Definition
(GenBank) UBA/THIF-type NAD/FAD binding fold family protein
  KO
K22132  tRNA threonylcarbamoyladenosine dehydratase
Organism
pmp  Pasteurella multocida 36950
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pmp03016]
    Pmu_02490
Transfer RNA biogenesis [BR:pmp03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    Pmu_02490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiF Sacchrp_dh_NADP NAD_binding_7 UDPG_MGDP_dh_N Cons_hypoth95 3HCDH_N Shikimate_DH DAO
Motif
Other DBs
NCBI-ProteinID: AET15192
Position
253723..254484
Genome map
AA seq 253 aa AA seqDB search
MERVDNYEQRFGGIARLYSTEGLTRLKQSHVCVIGIGGVGSWCVEALARSGVGKLTLIDM
DDICVTNINRQIHALSGNIGQLKTEVMKARVALINPECEVAIIDDFISSENLADYLSKGY
DYVIDAIDHVRTKAALIAYCKRHKINMITVGGAGGQTDPTQIQITDLSRTIQDPLLAKVR
SLLRKEYHFSQNPKRKFGIDCVFSTQPLIFPNVDGNCEVSASMNCANGFGAATMVTATFG
FFAVSRVINKLLR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggagagagtggataattatgaacaacgttttggtgggatcgcacgtttatacagtact
gaagggcttactcgtttaaaacagtctcatgtctgcgtcatcggtattggtggcgtcggt
tcatggtgtgtggaggcattagcgcgctcaggtgtgggcaaattgacgttaattgatatg
gatgatatttgcgtgaccaacattaaccgccaaatccatgcactttctggcaacattggg
caattaaagacagaagtgatgaaagcgcgggttgcgttaattaatcctgaatgtgaagtg
gcgattattgatgattttatttccagcgaaaacttagcggattatttatcgaaaggctat
gattatgtcattgatgcaatcgatcatgtcagaacgaaagccgcactcattgcttattgt
aaacgtcataaaattaacatgattactgttggtggagcaggaggtcaaaccgatccgact
cagatccaaattaccgatttaagtaggacgattcaagatccgctcttagcaaaagtacgt
tccttattacgtaaggaataccattttagccaaaatccaaaacgaaaatttggtattgat
tgtgtgttttccacacaacccttaatttttcccaacgtggatggcaattgtgaagtatca
gcaagtatgaactgtgccaatggctttggtgctgccactatggtgactgcaacttttgga
ttctttgcggtttctcgtgttattaataaactgttacgttaa

DBGET integrated database retrieval system