KEGG   Pasteurella multocida 36950: Pmu_02510Help
Entry
Pmu_02510         CDS       T01729                                 

Definition
(GenBank) putative long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00061  Fatty acid biosynthesis
pmp00071  Fatty acid degradation
pmp01100  Metabolic pathways
pmp01212  Fatty acid metabolism
pmp02024  Quorum sensing
Module
pmp_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:pmp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Pmu_02510
   00071 Fatty acid degradation
    Pmu_02510
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Pmu_02510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pmp01004]
    Pmu_02510
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pmp04147]
    Pmu_02510
Enzymes [BR:pmp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     Pmu_02510
Lipid biosynthesis proteins [BR:pmp01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   Pmu_02510
Exosome [BR:pmp04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   Pmu_02510
  Exosomal proteins of breast cancer cells
   Pmu_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AET15194
Position
complement(255784..257604)
Genome map
AA seq 606 aa AA seqDB search
MTNLNLHFVNRIREQAKLLLNETALRYHTPSGWENISWHQFQQDLDTFSYALLANHIGVQ
DKIAIFAHNMPRWTIADIGTMQVRAVVVPIYATSAAKQVEYILNNADVKILFVGDQEEYN
CTLEIIDACPQIQKIVAMKDNLDLKNHPKACDWQTFLLEGSPLQQTALQARLEQKQLTDL
FTLIYTSGTTGEPKGVMLDYANLAHQLKAHDEAFTTLNVSQYDSSLSFLPLSHIFERAWV
AYVLHRGAVNCYLEDTNRVREALSEIRPTLMCAVPRFYEKIYTAVWDKVQKAPLFRRMIF
NWAIAVGQKRFQFISQKKPIPFVLRQQYALADKLVLSKLRQLLGGRIRMMPCGGAKLEPN
IGLFFHSIGINVKLGYGMTETTATVSCWEEGHFEPNSIGTLMPGAEVKIGENNEILVRGG
MVMRGYYKKPQETADSFTEDGFLKTGDAGEFDPQGNLYITDRIKELMKTSNGKYIAPQYI
ETKVGKDKFIEQIAVIADAKKYVSALIVPCFNSLEEYAKQLNIKYHDRLELIKHSDILQM
FEQRINDLQKELPSFEQIKKFTLLPQAFTTKMEEITPTLKLRRKVILERYKAQIEAMYKE
YTHKKD
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgactaatttgaacttacactttgttaatcgcatccgcgaacaagccaagctcttatta
aatgaaactgccctacgttaccacacgccttcaggttgggaaaatatctcttggcaccaa
tttcaacaggatctcgacaccttttcttatgcgctcttagccaatcatattggggtacaa
gataaaattgccatttttgcacataatatgccacgttggactatcgctgacatagggaca
atgcaagtacgcgctgttgttgtgccaatctatgcgacaagtgccgccaaacaagtcgaa
tatatccttaacaacgcagatgtcaaaatcctctttgttggtgatcaagaagagtacaac
tgtacgctagaaatcatcgatgcttgtccacaaatacaaaaaattgtcgccatgaaagac
aatttggacttaaaaaatcatcctaaagcttgtgattggcaaacttttttgctcgaggga
agcccactccaacaaacagctctgcaagcgcgtcttgaacaaaaacaactgacagactta
tttactttaatctatacctcgggcacgacgggagaaccgaagggcgtgatgttggattac
gctaatcttgctcaccaattaaaagcgcatgacgaagcatttactacactcaatgtcagc
caatatgatagctcgctttctttcttaccgttatcccatatctttgaacgagcctgggtt
gcttatgttttacaccgtggtgcagtcaattgttatcttgaagatactaacagagtacgt
gaagctcttagcgaaattcgcccaactctgatgtgtgccgtgccacgtttttatgaaaaa
atttacaccgccgtttgggataaagtacaaaaagcacctctcttccgtcgtatgatcttc
aattgggcaattgcagttggacaaaaacgttttcagtttatttcacaaaagaaacctatc
ccttttgtactacggcaacaatatgcgctagccgataagttagtgttatctaaattacgt
caattactcggtggtcgcatccgcatgatgccttgtggcggtgcaaaattagagcctaac
attggactgtttttccacagtattggtattaatgtcaagctcggctacggtatgacagaa
accacggctaccgtatcttgctgggaagaagggcattttgaaccaaattctattggtaca
ttgatgcctggtgcagaagtcaaaattggggaaaataatgaaatcttagtgcgtggcggg
atggtcatgcgtggttattataaaaaaccacaagaaactgctgacagttttacagaagac
ggattcttaaaaactggtgatgctggggaatttgatccacaaggtaatttatatattaca
gatcgtatcaaagagttaatgaaaacctccaatggaaaatatattgctccacaatatatt
gaaaccaaagtgggtaaagataaatttattgaacaaattgcagtcattgcggatgccaaa
aaatatgtctcagcgcttattgtaccttgcttcaatagtcttgaagaatacgccaaacaa
ttaaatataaaatatcacgatcgtttagaactcattaaacattctgatattcttcaaatg
tttgaacagcgtattaatgatttacaaaaagaattgcctagctttgagcaaattaaaaaa
ttcactttattacctcaggcatttaccacaaaaatggaagaaattactccgacattgaaa
ctccgtcgtaaagtgattttagaacgctataaagcacaaattgaagcgatgtataaagaa
tacactcataaaaaagactaa

DBGET integrated database retrieval system