KEGG   Pasteurella multocida 36950: Pmu_02590Help
Entry
Pmu_02590         CDS       T01729                                 

Definition
(GenBank) putative chorismate--pyruvate lyase
  KO
K03181  chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
pmp  Pasteurella multocida 36950
Pathway
pmp00130  Ubiquinone and other terpenoid-quinone biosynthesis
pmp01100  Metabolic pathways
pmp01110  Biosynthesis of secondary metabolites
Module
pmp_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:pmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Pmu_02590
Enzymes [BR:pmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     Pmu_02590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chor_lyase
Motif
Other DBs
NCBI-ProteinID: AET15202
Position
265126..265638
Genome map
AA seq 170 aa AA seqDB search
MSDYSQLLQNATWQPSTDMQLPLSISSWLELSTSLTTQLKQAFGEVNVCVLAESWITTLN
ENERQFFPKQACPCWCREVILKSQDIPLIFARTLIPASLLTQHRELQQLGNRALGEWLFM
QSDRIRQKLELTHDKNTALYARRALMSIGAENMMVAELFLTPQIFTRVVK
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattattcccaattgttacaaaatgccacttggcagccttcaacggatatgcaa
ttacctctgtcgatttcttcttggctagagctatccacatctttaactacacagctaaaa
caagcttttggcgaagtgaatgtatgtgtcttagccgagtcatggataacgacgcttaac
gagaatgaacgtcaattttttccaaaacaagcatgcccgtgttggtgtcgagaagtgatc
ttaaaaagccaagatataccattaatttttgcgcgtactttaattccggcttctttattg
acgcagcatagagaattacaacaattgggcaatcgtgcgttaggtgagtggctgtttatg
caatctgatcgtataaggcaaaaattagaattaacgcatgataaaaacaccgcactttat
gcccgccgtgccttaatgagtattggcgctgagaatatgatggttgctgaattatttcta
acaccacaaatttttacgagagtagtcaaatga

DBGET integrated database retrieval system