KEGG   Pasteurella multocida 36950: Pmu_02710Help
Entry
Pmu_02710         CDS       T01729                                 

Definition
(GenBank) ISApl1 transposase
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_38 rve HTH_23 HTH_32 HTH_28 KorB Sigma70_r4_2 GerE HTH_29 HTH_11 KORA MarR HTH_31 Trp_repressor rve_3 HTH_24
Motif
Other DBs
NCBI-ProteinID: AET15208
Position
complement(276775..277698)
Genome map
AA seq 307 aa AA seqDB search
MILLAQGKKQAEIAKALGRSSSTISRELKRHALESYSATNAQNSYLKHRQNSKAQRKLEQ
PEYFNLVQEKFLTENWSPEQISARLKLEKSELSISYSTIYRGIYSGLFDIGERKASRKLR
HKGKTRHTKNHHEKRGKIQISNHLNDRPISAQNRSRFGHWKADTVLGKAGGACLLTLTER
KSRFELVKKIPAKKAEAVQKAMIELLDSHILRSITPDRGKEFAQHRLVTEALGVEFYFPE
PHQPWTRGTNENTNGLLREYFPKHQDINQWSEVDIQQVVNKLNLRPRKCLGWKTPYEVYF
KKTLHLV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgattttactcgcacagggcaaaaaacaagcagaaattgccaaagcactgggacgtagc
tccagcaccatttctcgcgagctgaaacgacacgctctagaaagctacagtgcaacgaac
gcacaaaacagctatttgaagcatcgtcaaaatagcaaagcacagcgcaaattagagcag
cctgaatatttcaatttggtgcaagaaaagtttctgacagaaaactggtcgcccgaacaa
atcagcgcacgattaaaattggaaaaatctgaattatccattagttattcaaccatttat
cgtggtatttattcagggttgtttgatataggcgaacgcaaagccagtcgcaaactgcgc
cacaaaggcaaaacacggcatacaaaaaatcatcatgaaaaacgtggcaaaattcagata
tccaaccatttgaacgaccgtcccatttcggcgcaaaatcgcagtcgctttggacattgg
aaagccgataccgtactgggtaaagcgggtggagcttgtttgctgacgctgacggaacgc
aaaagtcgttttgagttggtgaagaaaattcctgccaaaaaagccgaagcagtccaaaaa
gccatgattgaattgctggattcacatatattgcggtcaattacgccagaccgtggtaaa
gaatttgcccaacatcgtttggtaacagaagcactgggtgtagaattttacttccccgag
ccgcatcaaccgtggacacggggaacgaatgaaaatacaaatgggttacttcgtgaatac
tttccgaagcaccaagacatcaatcagtggagcgaagttgatattcaacaggtggtcaat
aaactgaatttacgaccgcgtaaatgtttgggttggaaaacaccttatgaagtttacttc
aaaaaaacgttgcacttggtttga

DBGET integrated database retrieval system