KEGG   Pasteurella multocida 36950: Pmu_02920Help
Entry
Pmu_02920         CDS       T01729                                 

Definition
(GenBank) hypothetical protein
Organism
pmp  Pasteurella multocida 36950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1738 Tox-MPTase3
Motif
Other DBs
NCBI-ProteinID: AET15222
Position
complement(297651..298625)
Genome map
AA seq 324 aa AA seqDB search
MNTQTKFDLYQHITDRIVAALEQGTAPWLKPWSHPECNMALPRNAVSNRLYSGINTLLLW
IATAEYGYKQSKWITAKKANELGGYIRKGEKATVVMNYRPDKREKLDEEGNIVYDEEGNP
EIEQHFFIKKHNLFNLDQCENLPEELYDPISEPKQPTSDPNQYEIFADIRQIIKGMDLHV
EMKPSNRAYYQPSADLVVMPEIKQFENAQAFHSVLLHEMTHATGAAKRLDREGITSGKAK
FGNKVYAFEELVAEMGGAFLCAYLGFDTVPQNAAYIESWIRVIKEDKRAIVRASGKAREA
CQYMLDALNISQLADKNEVFEEAA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcaaactaaatttgatttataccaacatatcacagaccgaattgttgcagca
ctggaacaggggactgcaccatggttaaaaccgtggagtcatccagaatgtaatatggca
ttacctcgtaatgcggtctctaaccgattgtattctggtatcaacacactattactctgg
attgctaccgcagaatacggttacaaacagagtaagtggattacagcaaaaaaagctaac
gagctcggcggatatatccgtaaaggtgaaaaagctactgttgtaatgaactaccgtcct
gataagagagaaaaacttgatgaggagggaaatattgtgtatgacgaggaaggtaatcca
gaaattgaacaacactttttcattaagaagcacaatctgttcaatctagaccagtgtgaa
aatttacccgaggaactgtacgatcctatatcagaacctaaacagcctacatcggatcca
aaccaatacgagatttttgctgatattcggcagattatcaaaggaatggatttacacgtg
gaaatgaaaccgagtaatcgggcatattatcaacccagtgcagatttagttgtaatgccg
gaaataaaacagtttgaaaatgctcaagcgtttcatagtgtgttattgcacgaaatgact
catgcaactggtgctgctaaaaggctcgatcgtgagggtattacctccggaaaagcaaaa
tttggaaacaaagtctatgcttttgaggagttggttgccgaaatggggggagcatttttg
tgtgcctaccttggatttgatacggtacctcaaaatgcggcatatattgaaagttggata
agagttataaaagaagataaacgggctattgtccgggcttctggtaaagctcgtgaagct
tgtcaatatatgttagatgcattaaatatctcacagctggctgataaaaacgaggtcttt
gaagaagcagcttaa

DBGET integrated database retrieval system